DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56a and Obp19d

DIOPT Version :10

Sequence 1:NP_611442.1 Gene:Obp56a / 37264 FlyBaseID:FBgn0034468 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_523421.2 Gene:Obp19d / 33040 FlyBaseID:FBgn0011280 Length:150 Species:Drosophila melanogaster


Alignment Length:139 Identity:35/139 - (25%)
Similarity:65/139 - (46%) Gaps:13/139 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VIALSALFVT--LAVGSSLNLSDEQ--KDLAKQHREQCAEEVKLTEEEKAKVNAKDFNNPTENIK 66
            ::.|:.|.:.  |.:|::.....|:  :|.|.:...:|..|...|:|:..::.:.|.....| .|
  Fly     4 LVHLTVLLLVGILCLGATSAKPHEEINRDHAAELANECKAETGATDEDVEQLMSHDLPERHE-AK 67

  Fly    67 CFANCFFEKVGTL-KDGEL--QESVVLEKLGALIGEEKTKAALE---KCRTIK-GENKCDTASKL 124
            |...|..:|:..: :.|:|  :.::.|.|:.:....||..|..|   ||..|: .|:.||.|...
  Fly    68 CLRACVMKKLQIMDESGKLNKEHAIELVKVMSKHDAEKEDAPAEVVAKCEAIETPEDHCDAAFAY 132

  Fly   125 YDC-FESFK 132
            .:| :|..|
  Fly   133 EECIYEQMK 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56aNP_611442.1 PBP_GOBP 24..128 CDD:460193 29/113 (26%)
Obp19dNP_523421.2 PBP_GOBP 26..139 CDD:460193 29/113 (26%)

Return to query results.
Submit another query.