DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56a and LOC3291552

DIOPT Version :10

Sequence 1:NP_611442.1 Gene:Obp56a / 37264 FlyBaseID:FBgn0034468 Length:139 Species:Drosophila melanogaster
Sequence 2:XP_061513859.1 Gene:LOC3291552 / 3291552 VectorBaseID:AGAMI1_008217 Length:133 Species:Anopheles gambiae


Alignment Length:91 Identity:17/91 - (18%)
Similarity:35/91 - (38%) Gaps:1/91 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 QCAEEVKLTEEEKAKVNAKDFNNPTENIKCFANCFFEKVGTLKDG-ELQESVVLEKLGALIGEEK 101
            :|..|.::.......:.|.:|:.....::||..||.::.|.:.|. ......::......:.:|.
Mosquito    30 RCRNEFEIEPSVFESLRAGNFSVRNSLVECFGECFVKRAGFMNDNFTFNRDTIMRFTNRFVSKEI 94

  Fly   102 TKAALEKCRTIKGENKCDTASKLYDC 127
            ::.....|........|.||..:|.|
Mosquito    95 SEKVYNICTDNVTPTYCVTAFDVYQC 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56aNP_611442.1 PBP_GOBP 24..128 CDD:460193 17/91 (19%)
LOC3291552XP_061513859.1 None

Return to query results.
Submit another query.