DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment isopeptidase-T-3 and ubac1

DIOPT Version :9

Sequence 1:NP_001261098.1 Gene:isopeptidase-T-3 / 37261 FlyBaseID:FBgn0028372 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_001016826.1 Gene:ubac1 / 549580 XenbaseID:XB-GENE-997434 Length:406 Species:Xenopus tropicalis


Alignment Length:409 Identity:112/409 - (27%)
Similarity:182/409 - (44%) Gaps:67/409 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 RVLIFKTDVNKRLNELKSEVILE-------------LSDDPDSIQLFAPDVRHLNPRYRLYRAEY 223
            |:.|...|..:.|.|:..|:.:|             ..:||.|:           ..::|..|  
 Frog    15 RLHICSLDGAEWLEEVTEEITVEKLKEKCLKHCSHGSLEDPKSL-----------THHKLVHA-- 66

  Fly   224 FGGE--LNEGDTLAQLKVRNNETFILSPRRNTLPQTVSRIREV----------PGPNEQLVESAT 276
             ..|  |::..|||:..:::|:..:|..:|  .|....::.||          ..|::..:..||
 Frog    67 -SSERVLSDTKTLAEENLQDNDVLLLVKKR--APPPTPKMAEVSADEKRKQDQKAPDKDAILKAT 128

  Fly   277 RYVPVNCNQLPTIDINEIFQQSNIQYDVRKVLISLAQASAAVIGAGPYAPRLI----AMLKQRLI 337
            ..:|...........|    ..:.|.::||:|:||.:.:..::...|.|..|.    |||.:...
 Frog   129 AGLPARSTDRTVAQHN----MRDFQTELRKILVSLIEVAQKLLALNPDAIELFKKANAMLDEDDE 189

  Fly   338 NRRNQQADTLQCLVDMGFKRELAAFALKAHNGIYSTTMEWLIQNQNE---------ENPQEPPGM 393
            :|.::.|  |:.|.:|||....|..||:.::...:..|||||::.::         ||..|..| 
 Frog   190 DRVDEVA--LRQLTEMGFPESRAVKALRLNHMSVTQAMEWLIEHADDPAADAPLPCENSSEAAG- 251

  Fly   394 NMQHSLSSISPSTIVTNNETIENTA-ALIEIV-RIYSHRDSPPSDEIVESLTEMGFEETAVLAAL 456
                .|::....|..|.....|:.. .|.||. :|...|:..|....|.:|.||||:|..|:.||
 Frog   252 ----GLATGEAETKPTLGAGAEDPKDELTEIFKKIRRKREFRPDPRAVIALMEMGFDEKEVIDAL 312

  Fly   457 KKTGNNKASACEWLCDNRSGSVIELREGLAPDSPILKVILEMPQVQMTLSNPKTFLAFLGILENE 521
            :...|.:.:|||||..:|..|..:|.:|:...||:.:.||:.|.||:.|:||||.|||..:|||.
 Frog   313 RVNNNQQDAACEWLLGDRKPSPEDLDKGIDTTSPLFQAILDNPVVQLGLTNPKTLLAFEDMLENP 377

  Fly   522 HAIRVWRGDNDTTSVITHI 540
            .....|..|.:|..|:..|
 Frog   378 LNSTQWMNDPETGPVMLQI 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
isopeptidase-T-3NP_001261098.1 UBA_like_SF 345..384 CDD:304366 13/38 (34%)
UBA2_KPC2 434..472 CDD:270489 17/37 (46%)
ubac1NP_001016826.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..122 5/28 (18%)
UBA1_KPC2 196..232 CDD:270488 14/37 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..272 8/38 (21%)
UBA2_KPC2 290..328 CDD:270489 17/37 (46%)
STI1 354..393 CDD:128966 17/38 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11500
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9409
Inparanoid 1 1.050 119 1.000 Inparanoid score I4627
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1163759at2759
OrthoFinder 1 1.000 - - FOG0006086
OrthoInspector 1 1.000 - - otm49179
Panther 1 1.100 - - LDO PTHR46738
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4908
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.100

Return to query results.
Submit another query.