DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15125 and Pifo

DIOPT Version :9

Sequence 1:NP_001286618.1 Gene:CG15125 / 37258 FlyBaseID:FBgn0034463 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_003749424.1 Gene:Pifo / 691223 RGDID:1586282 Length:244 Species:Rattus norvegicus


Alignment Length:203 Identity:41/203 - (20%)
Similarity:60/203 - (29%) Gaps:79/203 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QRPNAQEREKLRRQRSET--RLVVAGCNDLGF----------EYVVNPPVWPKVGFLRKIHRDSS 56
            |....:|.|.|||.....  .:.....|...|          .|  :||.|  :|          
  Rat    35 QPDKTKENESLRRNEHHALWDITHGKVNKYSFGTRQARKLFPHY--HPPTW--LG---------- 85

  Fly    57 GDFCRDSY--TKNIPSVAPNTYDVPRPMGFKY------PSKAGFSALANKMPRLPIFRELGYPPI 113
                 ::|  .:.:|...|..|......|..|      .|..|::..|....|        :.||
  Rat    86 -----NTYLPLRGLPHTGPGCYAATDWNGLAYNLSKVPTSTKGYAIGARTSVR--------FKPI 137

  Fly   114 GSYATDFPG------------TQYYFTFN------KQTVREQKWLTPGPSTY----------THH 150
            ....|.:||            .:.:..||      |..|:...:  |||.||          :..
  Rat   138 NKDVTPYPGMYQKVDISSEKHKKCFAPFNILMPRFKSDVKGDSY--PGPGTYNPKNNSVPKVSWP 200

  Fly   151 LKY--PDW 156
            :|:  |||
  Rat   201 MKFGSPDW 208



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C542
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094638at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108337
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.