DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15125 and LOC110437716

DIOPT Version :9

Sequence 1:NP_001286618.1 Gene:CG15125 / 37258 FlyBaseID:FBgn0034463 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_009295291.2 Gene:LOC110437716 / 110437716 -ID:- Length:227 Species:Danio rerio


Alignment Length:122 Identity:32/122 - (26%)
Similarity:46/122 - (37%) Gaps:35/122 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GDFCRDSYTKNIPSVAPNTYDVPRPMGFKYPSKAGFSALANKMPR-LPIFRELGYPPIGSYATDF 120
            |..|.|::|     |....|::..    |..||.|:...|....| ||..:.: .|....|..|:
Zfish    84 GPGCYDNHT-----VGTLLYELQH----KPESKRGYVFAARTASRFLPALKAV-TPSPQKYQLDW 138

  Fly   121 -------PGTQYYFTFNKQTVR---EQKWLTPGPSTYTHH---------LKY--PDW 156
                   ||..   .||..|:|   :...::|||..|.|.         :|:  |||
Zfish   139 TLPKVCPPGKA---PFNSTTLRFRPKDAEISPGPGAYAHDAIQSKVSWPMKFGSPDW 192



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094638at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.