Sequence 1: | NP_001286618.1 | Gene: | CG15125 / 37258 | FlyBaseID: | FBgn0034463 | Length: | 282 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001186957.1 | Gene: | Pifo / 100503311 | MGIID: | 1923670 | Length: | 246 | Species: | Mus musculus |
Alignment Length: | 184 | Identity: | 36/184 - (19%) |
---|---|---|---|
Similarity: | 59/184 - (32%) | Gaps: | 65/184 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 NPPVWPKVGFLRKIHRDSSGDFCRDSYTKNIPSVAPNTYDVPRPMGFKYPSKAGFSALANKMPRL 102
Fly 103 PIFRELGY----------PPIGSYATDFPG------------TQYYFTFN------KQTVREQKW 139
Fly 140 LTPGPSTYTHHLK-YP--DWDVETAFGSKRIIWPAVAVFCSPQNIVKCSTCGEK 190 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_2C542 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_108337 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.800 |