DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15125 and Pifo

DIOPT Version :9

Sequence 1:NP_001286618.1 Gene:CG15125 / 37258 FlyBaseID:FBgn0034463 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001186957.1 Gene:Pifo / 100503311 MGIID:1923670 Length:246 Species:Mus musculus


Alignment Length:184 Identity:36/184 - (19%)
Similarity:59/184 - (32%) Gaps:65/184 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NPPVWPKVGFLRKIHRDSSGDFCRDSYTKNIPSVAPNTYDVPRPMGFKYPSKAGFSALANKMPRL 102
            :||.|     |..::....|          :|...|..          |.:...::.||..:.::
Mouse    80 HPPTW-----LGNLYLPLRG----------MPHTGPGC----------YAAATDWNGLAYNLSKV 119

  Fly   103 PIFRELGY----------PPIGSYATDFPG------------TQYYFTFN------KQTVREQKW 139
            |...: ||          .||....|.:||            .:.:..||      :...:...:
Mouse   120 PTSTK-GYAIGARTAVRFKPISKDVTPYPGMYQKVDTLSEKHKKSFAPFNILMPRFRSAAKGDSY 183

  Fly   140 LTPGPSTYTHHLK-YP--DWDVETAFGSKRIIWPAVAVFCSPQNIVKCSTCGEK 190
              |||.||...:| .|  .|.::  |||..  |..|.  |..:..:|.....:|
Mouse   184 --PGPGTYNPEMKSVPKVTWPMK--FGSPD--WSQVP--CLEKRTLKAELSADK 229



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C542
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108337
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.