DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sm and AT1G06960

DIOPT Version :9

Sequence 1:NP_001246428.1 Gene:sm / 37254 FlyBaseID:FBgn0003435 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_850936.1 Gene:AT1G06960 / 837206 AraportID:AT1G06960 Length:229 Species:Arabidopsis thaliana


Alignment Length:159 Identity:36/159 - (22%)
Similarity:58/159 - (36%) Gaps:39/159 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 NLVCL---YGNVARIKFLKTKE--GTAMVQMGDAVAVERCVQHLNNIP-VGTGGKIQIAFSKQNF 395
            :|.||   :|.:..:..|||.:  |.|.|...:..|....|:.:.|.| .....:||.|.||.::
plant    29 SLYCLFSQFGRLLDVVALKTPKLRGQAWVVFTEVTAASNAVRQMQNFPFYDKPMRIQYAKSKSDY 93

  Fly   396 LSEVINPFLLPD------------------HSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILH 442
            :::....|:..:                  ..||......::|...:.|.|.|.....||:.||.
plant    94 VTKAEGSFVPKEKKMKQEEKVERKRHAEETQQPSMPNGATTQNGMPVPPFQPSGQDTMPPNNILF 158

  Fly   443 FFNTP---------------PGLTEDQLI 456
            ..|.|               ||..|.::|
plant   159 IHNLPIETNSMMLQLLFEQYPGFKEIRMI 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smNP_001246428.1 RRM2_hnRNPL_like 80..165 CDD:241138
RRM3_hnRNPL_like 319..390 CDD:240870 16/58 (28%)
RRM4_hnRNPL_like 437..519 CDD:240873 9/35 (26%)
AT1G06960NP_850936.1 RRM1_U1A_like 12..88 CDD:409692 16/58 (28%)
RRM2_U1A_like 153..225 CDD:409693 9/35 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10501
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.