DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sm and PTB2

DIOPT Version :9

Sequence 1:NP_001246428.1 Gene:sm / 37254 FlyBaseID:FBgn0003435 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_200130.1 Gene:PTB2 / 835399 AraportID:AT5G53180 Length:429 Species:Arabidopsis thaliana


Alignment Length:219 Identity:73/219 - (33%)
Similarity:107/219 - (48%) Gaps:42/219 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKN-GVQAMVEFDNLDA 131
            |.::..||    :::||.:|.|..|.:|:||||.:....|:|.:|.:|.|| ||||::::.::..
plant   235 DGKKMEPE----SNVLLASIENMQYAVTLDVLHMVFAAFGEVQKIAMFDKNGGVQALIQYSDVQT 295

  Fly   132 ATRARENLNGADIY-AGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTVKEIGNGRSPLLQEPLY 195
            |..|:|.|.|..|| .|.|.|.|.|::...|::..|. |.|.|||:.      |...|:.|:|:.
plant   296 AVVAKEALEGHCIYDGGFCKLHITYSRHTDLSIKVNN-DRSRDYTMP------NPPVPMPQQPVQ 353

  Fly   196 VATLSTPQQ-HVSHQHHHHLRQQQQQQHQQQAPQQQPHPQ---------HLHHQQQLVAPAQSHN 250
            ......||| |.:...||      |||.|.|....||..|         |.|:    :||..|.:
plant   354 NPYAGNPQQYHAAGGSHH------QQQQQPQGGWVQPGGQGSMGMGGGGHNHY----MAPPSSSS 408

  Fly   251 LYQFKEPPLLGPGAAFPP--FGAP 272
            ::|       |||...||  :|.|
plant   409 MHQ-------GPGGHMPPQHYGGP 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smNP_001246428.1 RRM2_hnRNPL_like 80..165 CDD:241138 33/86 (38%)
RRM3_hnRNPL_like 319..390 CDD:240870
RRM4_hnRNPL_like 437..519 CDD:240873
PTB2NP_200130.1 RRM1_PTBPH1_PTBPH2 16..96 CDD:241130
RRM2_PTBPH1_PTBPH2 110..204 CDD:241135
RRM3_PTBPH1_PTBPH2 243..339 CDD:241134 37/96 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1545178at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.