DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sm and Ptbp3

DIOPT Version :9

Sequence 1:NP_001246428.1 Gene:sm / 37254 FlyBaseID:FBgn0003435 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_112636.1 Gene:Ptbp3 / 83515 RGDID:621671 Length:523 Species:Rattus norvegicus


Alignment Length:454 Identity:122/454 - (26%)
Similarity:182/454 - (40%) Gaps:133/454 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 ILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNG-VQAMVEFDNLDAATRARENLNGADIY 145
            :|...|.|.|||:|::|||:|....|.||:|:.|.||. .||::::.:...|..|:..|:|.:||
  Rat   152 VLRIIIENLFYPVTLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVNAQYAKMALDGQNIY 216

  Fly   146 AGCCTLKIDYAKPEKLNV-YKNEPDTSWDYT---LSTVKEIGNGRSPLLQEPLYVATLSTPQQHV 206
            ..||||:||::|...||| |.|  |.|.|:|   |.|    |:|:..|                 
  Rat   217 NACCTLRIDFSKLTSLNVKYNN--DKSRDFTRLDLPT----GDGQPSL----------------- 258

  Fly   207 SHQHHHHLRQQQQQQHQQQAPQQQPHPQHLHHQQQLVAPAQSHNLYQFKEPPLLGPGAAFPPFGA 271
                                                             |||:   .||   |||
  Rat   259 -------------------------------------------------EPPM---AAA---FGA 268

  Fly   272 PEYHTTTPENWKGAA-IHPTGLMKEPAGV----VPGRNAPVAFT------------PQGQAQGAV 319
            |...::.   :.||| ..|.....:.||:    |||...|:..|            ..|....:|
  Rat   269 PGIMSSP---YAGAAGFAPAIAFPQAAGLSVSAVPGALGPLTLTSSAVSGRMAIPGASGIPGNSV 330

  Fly   320 MMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGG 384
            ::|..|:.|......||.|..:||:|.|:|.:..|:..|:|||.||...:..:.||         
  Rat   331 LLVTNLNPDFITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADASQAQIAMNHL--------- 386

  Fly   385 KIQIAFSKQNFLSEVINPFL-------LP----DHSPSFKEYTGSKNNRFLSPAQASKNRIQPPS 438
                  |.|....:|:...|       ||    :.....|:::.|..:||..|...:...|.|||
  Rat   387 ------SGQRLYGKVLRATLSKHQAVQLPREGQEDQGLTKDFSNSPLHRFKKPGSKNFQNIFPPS 445

  Fly   439 KILHFFNTPPGLTEDQLIGIFNIKDVPATSVRLFPLKTERSSSGLIEFSNISQAVLAIMKC-NH 501
            ..||..|.||.:|.|.|..:|.   ....||:.|....:.....||:..::.:|:.|:::. ||
  Rat   446 ATLHLSNIPPSVTMDDLKNLFT---EAGCSVKAFKFFQKDRKMALIQLGSVEEAIQALIELHNH 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smNP_001246428.1 RRM2_hnRNPL_like 80..165 CDD:241138 36/84 (43%)
RRM3_hnRNPL_like 319..390 CDD:240870 21/70 (30%)
RRM4_hnRNPL_like 437..519 CDD:240873 20/66 (30%)
Ptbp3NP_112636.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
hnRNP-L_PTB 28..523 CDD:273733 122/454 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 406..426 3/19 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1545178at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.