DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sm and U1A

DIOPT Version :9

Sequence 1:NP_001246428.1 Gene:sm / 37254 FlyBaseID:FBgn0003435 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_182280.1 Gene:U1A / 819371 AraportID:AT2G47580 Length:250 Species:Arabidopsis thaliana


Alignment Length:326 Identity:71/326 - (21%)
Similarity:116/326 - (35%) Gaps:102/326 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PNHILLFTIINPFYPITVDVLHK----ICHPHGQVLRIVIFK--KNGVQAMVEFDNLDAATRARE 137
            ||..:....:|.  .:.:|.|.|    :....|::|.|:.||  |:..||.|.|||.::|:.|..
plant    16 PNQTIYINNLNE--KVKLDELKKSLNAVFSQFGKILEILAFKTFKHKGQAWVVFDNTESASTAIA 78

  Fly   138 NLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTVKEIGNGRSPLLQEPLYVATLSTP 202
            .:|....|..  .::|.|||                 |.|.|....:|.                
plant    79 KMNNFPFYDK--EMRIQYAK-----------------TKSDVVAKADGT---------------- 108

  Fly   203 QQHVSHQHHHHLRQQQQQQHQQQAPQQQPHPQHLHHQQQLVAPAQSHNLYQFKEPPLLGPGAAFP 267
                      .:.::::::|:::...::...|| |...|:..|..|      ..|.:.|   |.|
plant   109 ----------FVPREKRKRHEEKGGGKKKKDQH-HDSTQMGMPMNS------AYPGVYG---AAP 153

  Fly   268 PFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAFTPQGQAQGAVMMVYGLDHDTSNT 332
            |.....|                     |.|:.|  |.|.|..|...    ::.|..|.|:|:..
plant   154 PLSQVPY---------------------PGGMKP--NMPEAPAPPNN----ILFVQNLPHETTPM 191

  Fly   333 DKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQ-----IAFSK 392
             .|..|.|.|.....::.::.|.|.|.|:..|.:.....:|.|.      |.|||     |.::|
plant   192 -VLQMLFCQYQGFKEVRMIEAKPGIAFVEFADEMQSTVAMQGLQ------GFKIQQNQMLITYAK 249

  Fly   393 Q 393
            :
plant   250 K 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smNP_001246428.1 RRM2_hnRNPL_like 80..165 CDD:241138 25/90 (28%)
RRM3_hnRNPL_like 319..390 CDD:240870 20/75 (27%)
RRM4_hnRNPL_like 437..519 CDD:240873
U1ANP_182280.1 RRM1_U1A_like 19..96 CDD:409692 22/80 (28%)
RRM2_U1A_like 175..246 CDD:409693 19/81 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10501
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.