DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sm and CG18823

DIOPT Version :9

Sequence 1:NP_001246428.1 Gene:sm / 37254 FlyBaseID:FBgn0003435 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_659571.1 Gene:CG18823 / 59184 FlyBaseID:FBgn0042146 Length:106 Species:Drosophila melanogaster


Alignment Length:48 Identity:14/48 - (29%)
Similarity:22/48 - (45%) Gaps:3/48 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 PITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEFDNLDAATRARENLN 140
            |.|...|..:|.|.|::|..:|....|   .::|.....||.|.:.|:
  Fly    23 PCTRQELVMLCLPFGKILGSLIVDNEG---FIQFARESEATSAIDALD 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smNP_001246428.1 RRM2_hnRNPL_like 80..165 CDD:241138 14/48 (29%)
RRM3_hnRNPL_like 319..390 CDD:240870
RRM4_hnRNPL_like 437..519 CDD:240873
CG18823NP_659571.1 RRM <9..>79 CDD:223796 14/48 (29%)
RRM_1 16..76 CDD:278504 14/48 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1545178at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.