DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sm and PABPC1

DIOPT Version :9

Sequence 1:NP_001246428.1 Gene:sm / 37254 FlyBaseID:FBgn0003435 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_002559.2 Gene:PABPC1 / 26986 HGNCID:8554 Length:636 Species:Homo sapiens


Alignment Length:416 Identity:76/416 - (18%)
Similarity:126/416 - (30%) Gaps:119/416 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 VEFDNLDAATRA-----RENLNGADIYAGCCTLKID----------------YAKPEKLNVYKNE 167
            |.|:..:.|.:|     .:.|||..||.|....|::                ..:.:.:|:|...
Human   236 VSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKN 300

  Fly   168 PDTSWD-----------YTLSTVKEIGNG-----------RSP--------------LLQEPLYV 196
            .|...|           .|:::.|.:..|           .||              :..:||||
Human   301 LDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYV 365

  Fly   197 ATLSTPQQHVSHQHHHHLRQQQQQQHQQQAPQQQPHPQHLHHQQQLVAPAQSHNLYQFKEPPLLG 261
            |.....::..:     ||..|..|  :..:.:..|:|....:|     ||.....:....|....
Human   366 ALAQRKEERQA-----HLTNQYMQ--RMASVRAVPNPVINPYQ-----PAPPSGYFMAAIPQTQN 418

  Fly   262 PGAAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVVPGRNAPVAFT--PQGQAQGAVMMVYG 324
            ..|.:||....:...:.....:||..||  ....|..:.|....|...|  |.......||....
Human   419 RAAYYPPSQIAQLRPSPRWTAQGARPHP--FQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQR 481

  Fly   325 LDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIP--------VG 381
            :.:.::.|        :....|......|.....:.|...|..|....||||..|        |.
Human   482 VANTSTQT--------MGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVH 538

  Fly   382 TGGKIQIAFS---------KQNFLSEVINPFLLPDHSPSFKEYTG---SKNNRFLSPAQASKNRI 434
            ..|:..:..|         ::..|.|.:.|.:...|.....:.||   ..:|             
Human   539 VQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDN------------- 590

  Fly   435 QPPSKILHFFNTPPGLTE--DQLIGI 458
               |::||...:|..|..  |:.:.:
Human   591 ---SELLHMLESPESLRSKVDEAVAV 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
smNP_001246428.1 RRM2_hnRNPL_like 80..165 CDD:241138 12/61 (20%)
RRM3_hnRNPL_like 319..390 CDD:240870 15/78 (19%)
RRM4_hnRNPL_like 437..519 CDD:240873 6/24 (25%)
PABPC1NP_002559.2 PABP-1234 11..615 CDD:130689 76/416 (18%)
CSDE1-binding 166..289 11/52 (21%)
(Microbial infection) Binding to HRSV M2-1 protein. /evidence=ECO:0000269|PubMed:31649314 541..636 15/89 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.