DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56d and Ir7d

DIOPT Version :9

Sequence 1:NP_611432.1 Gene:Ir56d / 37252 FlyBaseID:FBgn0034458 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster


Alignment Length:430 Identity:83/430 - (19%)
Similarity:159/430 - (36%) Gaps:126/430 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EMFYRITQLYHFKNFIFYISERLDLNNKDSQEFFHN------FWTYFPMAPNLIITREHHLGIPM 92
            ::|.....:|:|..||....|.:|   :|.....|.      :...||:|  :::..:.:..|..
  Fly    41 KIFINGLAVYNFGVFISTSYEEMD---RDRVILVHQVLNRNLYPPNFPVA--VVLASKMNRKITA 100

  Fly    93 MQFISTPSLVMVFTTGKDDPIMELASHNQQGIHWLKTIFVLFPSLQSRDFETNPESLAQFTAEIK 157
            ..|..     ::|....:..|......|:.|:    .:.||..|...|...|.     .||..::
  Fly   101 QVFTQ-----LLFVQNAEQAIAIAEGVNRNGL----CVIVLLTSQPERPIMTK-----IFTYFMQ 151

  Fly   158 DVYDWVWRKQFINTFLITIK---DNVFILDPYPTPS---------IVNKTG-VWQAEEFFHKYAK 209
            :.|:       ||..::..:   ...|.:.|| ||:         |..|.| :|   :.|.:..|
  Fly   152 ERYN-------INVVILVPRLHGVQAFNVRPY-TPTSCSSLEPVEIDIKDGDLW---DVFPRRLK 205

  Fly   210 NMKGYLVRTPILYDMP---RV-FKSDRPTNRYE-------------KNF---IHGTSGNLFLGFL 254
            |:.|..: :.|::|:|   |: :||..|.:..:             .||   :.....|..:|..
  Fly   206 NLHGCPL-SVIVWDIPPYMRINWKSSDPMDGLDGLDGLLLRIVARKMNFTLKLIPNEPNGLIGGS 269

  Fly   255 EFVNAT-------LMDTSANV-----------------TADYLNMTNLLDLVSQG---VYETLIH 292
            .|:|.|       |.:..||:                 |:.|..|:.::.|.::|   :||.::.
  Fly   270 SFMNGTFTGAYKMLRERRANITIGCAACTPERSTFLEATSPYSQMSYIIVLQARGGYSIYEVMLF 334

  Fly   293 SFTEIT---TKFVVSYSYPIGINDCCIMVPYRNQSP-ADQYMHEALQENVWVLISLFTLYITVAI 353
            .|.:.|   ...::...:.:|..       :|..|| ...:|       :|:.:...:...:|..
  Fly   335 PFEKYTWLLLSTILGLHWIVGSR-------WRMPSPILAGWM-------LWIFVIRASYEASVFN 385

  Fly   354 YL-CSPLRP------RDLSAAFL----QSICTLTYSVPTF 382
            :: .||::|      :.||..|.    .:...:|..:|:|
  Fly   386 FIQNSPVKPSPRTLDQALSGGFRFITDHASYRMTLKIPSF 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir56dNP_611432.1 ATPase-IIIA_H <312..422 CDD:273731 15/83 (18%)
Ir7dNP_001138175.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.