DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56d and Ir87a

DIOPT Version :9

Sequence 1:NP_611432.1 Gene:Ir56d / 37252 FlyBaseID:FBgn0034458 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster


Alignment Length:528 Identity:100/528 - (18%)
Similarity:185/528 - (35%) Gaps:163/528 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 EEFFH-----KYAKNMKGYLVRTPILYDMPRVFKS--DRPTNRY------EKNFIHGTS------ 246
            ||||.     |:.:::.|..:........|.:|::  ::|.:.|      :::..:.||      
  Fly   316 EEFFRAKFEDKFPRDLSGCPLTASFRPWEPYIFRNSEEQPVDDYYYGLQGDEDDYNDTSPNYGES 380

  Fly   247 ------------------------GNLFLGFLEF----VNATLMDTSANVTADYLNMTNLLDLVS 283
                                    |.|.|..:|:    ..|..:..|..:..:..|:.:|...:.
  Fly   381 DDESYADPGEDGDGAIPDTETQSGGKLKLSGIEYEMVQTIAERLHVSIEMQGENSNLYHLFQQLI 445

  Fly   284 QGVYETLIHSFTE--ITTKFVVSYSYPIGINDCCIMVPYRNQSPADQYMHEALQENVW------- 339
            .|..|.::....|  ..::||.|            .:||          |:  .|..|       
  Fly   446 DGEIEMIVGGIDEDPSISQFVSS------------SIPY----------HQ--DELTWCVARAKR 486

  Fly   340 ----------------VLISLFTLYITVAIYLC---SPLRPRDLSAAFLQSI----CTLTYSVPT 381
                            .||.:|.:..::.::|.   |..:.|:|:..|...:    ..|..::|.
  Fly   487 RHGFFNFVATFNADAGFLIGIFVVTCSLVVWLAQRVSGFQLRNLNGYFPTCLRVLGILLNQAIPA 551

  Fly   382 FIIRTPTLRMRYLYILLAIWGIVTSNLYISRMTSYFTTAPPVRQINTVQDVVEANLRIKMLAIEY 446
               :...:.:|.|:.|..:.|...||.|.|.:.|..||.....||:|:|::....:.: |...|:
  Fly   552 ---QDFPITLRQLFALSFLMGFFFSNTYQSFLISTLTTPRSSYQIHTLQEIYSNKMTV-MGTSEH 612

  Fly   447 ERMAKSPLQYPESYLNQVDLVDKHMLDLHRDPFNTSFGYTVSSDRWRFLN--LQQLHLRKPIFRL 509
            .|           :||:...:.|::    |:.|...:...      ..||  .|..|:...:.| 
  Fly   613 VR-----------HLNKDGEIFKYI----REKFQMCYNLV------DCLNDAAQNEHIAVAVSR- 655

  Fly   510 TEICEGPFYH----------------------VFPLHKDSHMRSVMTEYIMIAQQAGLMNHWERE 552
                :..||:                      ...|.|..|:...:...|....::|.|..|.|:
  Fly   656 ----QHSFYNPRIQRDRLYCFDRRESLYVYLVTMLLPKKYHLLHQINPVIQHIIESGHMQKWARD 716

  Fly   553 TFWEAVHLHRIHVHLFDDEPMALSLDFFSSLLRTWTLGLIL-AGLAFAAEMKWHEHV--TFKR-R 613
            .....: :|.....:.:|...||:.|.|...: .::.||:| |...||.|:.:.::|  |.|| |
  Fly   717 LDMRRM-IHEEITRVREDPFKALTFDQFRGAI-AFSGGLLLVASCVFAFELCYVKYVYRTEKRER 779

  Fly   614 PVIRITRK 621
            ...:||:|
  Fly   780 KTKKITKK 787

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir56dNP_611432.1 ATPase-IIIA_H <312..422 CDD:273731 26/139 (19%)
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 15/90 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.