DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56d and Ir94a

DIOPT Version :9

Sequence 1:NP_611432.1 Gene:Ir56d / 37252 FlyBaseID:FBgn0034458 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_732699.1 Gene:Ir94a / 318610 FlyBaseID:FBgn0051164 Length:595 Species:Drosophila melanogaster


Alignment Length:508 Identity:81/508 - (15%)
Similarity:190/508 - (37%) Gaps:104/508 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 IKDVYDWVWRKQFINTFLITIKD----NVFI----LDPYPTPSIVNKTGVWQAEEFFHKYAKNMK 212
            |:|:...|...||::..::.:::    .||.    |..:|.|.......|:..:..|:: ..|..
  Fly   135 IEDITHEVKNLQFLHLIVLIVQEKYNGQVFASTLRLQSFPEPHFKRIRNVFAIQRIFYR-PINFH 198

  Fly   213 GYLVRTPILYDMPRVFKSDRPTNRYEKNFIHGTSGNLFLGFLEFVNATL------MDTSANVTAD 271
            |.::.. |..|:|.:|.:               ...:|..:....|:||      :.....:|.|
  Fly   199 GKVLNA-IPNDIPILFVA---------------LNEMFTEYARRYNSTLRIQNRTIKEDIEITED 247

  Fly   272 YLNMTNLLDLVSQGVYETLIHSFTEITTKFVVSYSYPIGINDCCIMVPYRNQ-SPADQYMHEALQ 335
            ..::...:.|.:.   :..:|.         ::.:..||.|...|:||...: ...|.:....::
  Fly   248 NYDIDMKIQLHNS---QNFLHH---------MNIAMDIGSNSLIILVPCATELRGLDIFKELGVR 300

  Fly   336 ENVWVLISLFTLYITVA---IYLCSPLRPRDLSAAFLQSICTLTYSVPTFIIRTPTLRMRY---- 393
            ...|:.:..:.:::.|.   :::.:....|:.:..:...:..|. :|...:.:|..:..||    
  Fly   301 TLTWLALLFYIIFVLVEMLFVFISNRFNGRNFTMRYTNPLINLR-AVRAILGQTSPISNRYSLSI 364

  Fly   394 --LYILLAIWGIVTSNLYISRMTSYFTTAPPVRQI----------------NTVQDVVEANLRIK 440
              .::.::::|.:....:..::.|:.|..|...||                :|.:..:|..:...
  Fly   365 QHFFVFMSLFGTLFGGFFDCKLRSFLTKRPYYSQIENFSELRKSGVTVVVDHTTRQFIEQEINAN 429

  Fly   441 MLAIEYERMAKSPLQYPESYLNQVDLVDKHMLDLHRDPFNTSFGYTVSSDRWRFLNLQQLHLRKP 505
            ....|...:..:.:|         :|::      |...::..|.:..:|..||....:...:.:.
  Fly   430 FFRDEVPNVRTTTIQ---------ELIN------HVYSYDRKFAFVANSIPWRTFREEMKSINQK 479

  Fly   506 IF----RLTEICEGPFYHVFPLHKDSHMRSVMTEYIMIAQQAGLMNHWERETFWEAVHLHRIHVH 566
            |.    .||.:...|.  .|.:.:::.....:..:|:.|..:|::..|    |..|..:.|.|:.
  Fly   480 ILCDSKNLTILENVPL--TFSIRRNAIFSHHLRNFIINAADSGMITCW----FKMAGKVIRKHIK 538

  Fly   567 L----FDDEP--MALSLDFFSSLLRTWTLGLILAGLAFAAEMKWHEHVTFKRR 613
            .    .:.:|  :.||.|.|..|.....:..:::.:.|..|:.|.:   ::||
  Fly   539 TTLRESEQQPSHLPLSFDHFKWLWAVLCIAYVMSFMVFVMEILWSK---YQRR 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir56dNP_611432.1 ATPase-IIIA_H <312..422 CDD:273731 16/119 (13%)
Ir94aNP_732699.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.