DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56d and Ir7b

DIOPT Version :9

Sequence 1:NP_611432.1 Gene:Ir56d / 37252 FlyBaseID:FBgn0034458 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster


Alignment Length:479 Identity:91/479 - (18%)
Similarity:162/479 - (33%) Gaps:143/479 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 EIKDVYDWVWRKQFINTFLITIK--DNVFILDPYP----------TPSIVNK----TGVWQAEEF 203
            |::....::||...:|..::...  |::.::..:|          :.::||:    |..|.::::
  Fly   135 EMQATLRFLWRLSVLNVGVVLRPPGDHILMVSYFPFSALHGCQVISANVVNRYQVGTKRWASQDY 199

  Fly   204 FHKYAKNMKGYLVRTPILYDMP-RVFKSDRPTNRYEKNFIHGTSGNLFLGFLEFVNATL------ 261
            |.....|..|.|:......||| .|::.|.     ..:|: |..|.|.....|.:|.|:      
  Fly   200 FPSKLGNFYGCLLTCATWEDMPYLVWRPDG-----SGSFV-GIEGALLQFMAENLNFTVGLYWMN 258

  Fly   262 -------MDTSANV-------TADY----------------------------LNMTNLLDLVSQ 284
                   .|.|..:       .||:                            :.:|||....| 
  Fly   259 KEEVLATFDESGRIFDEIFGHHADFSLGGFHFKPSAGSEIPYSQSTYYFMSHIMLVTNLQSAYS- 322

  Fly   285 GVYETLIHSFTEITTKFVVSYSYPIG---INDC---CIMVPYRNQSPADQYMHEALQENVWVLIS 343
             .||.|...||.:..:       .||   |..|   .::|.:|:        |..|..|.:    
  Fly   323 -AYEKLSFPFTPLLWR-------AIGLVLILACLLLMLLVRWRH--------HHELPRNPY---- 367

  Fly   344 LFTLYITVAIYLCSPLRPRDLSAAFLQSICTLTYSVPTFIIRTPTLRMRYLYILLAIWGIVTSNL 408
                |..:.:.:...|..|.:...|...:..||:...|.::|:               |..:...
  Fly   368 ----YELLVLTMGGNLEDRWVPQRFPSRLVLLTWLFATLVLRS---------------GYQSGMY 413

  Fly   409 YISRMTSYFTTAPPVRQINTVQDVVEANLRIKMLAIEYER-MAKSPLQYPES--YLNQVDLVDKH 470
            .:.|..:  ...||    .|:.:|:..:..|::..:...| :|..|...||.  ||...:|    
  Fly   414 QLLRQDT--QRNPP----QTISEVLAQHFTIQLAEVNEARILASLPELRPEQLVYLEGSEL---- 468

  Fly   471 MLDLHRDPFNTSFGYTVSSDRWRFLNLQQL--HLRK--PIFRLTEICEGPFYH---VFPLHKDSH 528
                  ..|......:.||.|...|...:.  :.||  |:.|...:.....|.   .|.:.:.||
  Fly   469 ------QSFPALAQQSGSSARVAILTPYEYFGYFRKVHPMSRRLHLVRERIYTQQLAFYVRRHSH 527

  Fly   529 MRSVMTEYIMIAQQAGLMNHWERE 552
            :..|:.:.|..|...|.:.||.|:
  Fly   528 LVGVLNKQIQHAHTHGFLEHWTRQ 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir56dNP_611432.1 ATPase-IIIA_H <312..422 CDD:273731 16/112 (14%)
Ir7bNP_572410.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.