DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56d and Ir7a

DIOPT Version :9

Sequence 1:NP_611432.1 Gene:Ir56d / 37252 FlyBaseID:FBgn0034458 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster


Alignment Length:302 Identity:62/302 - (20%)
Similarity:114/302 - (37%) Gaps:65/302 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   338 VWVLISLFTLYITVAIYLCSPL--RPRDLSAAFLQSICTL------TYSVPTFIIRTPTLRMRY- 393
            ||:.:.:.:|.:.:.:::.:.|  ...||::..||.:.||      ..|:|    |:..||:.| 
  Fly   348 VWLALVVSSLLLVLVLWMRNRLVCGRSDLASHALQVLTTLMGNPLEARSLP----RSSRLRILYA 408

  Fly   394 --LYILLAIWGIVTSNLYISRMTSYFTTAPPVRQINTVQDVVEANLRIKMLAIEYERMAKSPLQY 456
              |.::|.:..:....|:.|....|....|     ..:.:::.:|..:                 
  Fly   409 GWLLLVLVLRVVYQGKLFDSFRLPYHKPLP-----TEISELIRSNYTL----------------- 451

  Fly   457 PESYLNQ--VDLVDKHMLDLHRDPFNTSFGY----------TVSS--DRWRFLNLQQLHLRKPIF 507
                :||  :|...:.:..|.|:.....|.|          |.:|  ....:.|:  :|....  
  Fly   452 ----INQEYLDYYPRELTVLTRNGSKDRFDYIQGLGKEGKFTTTSLIATMEYYNM--MHWSTS-- 508

  Fly   508 RLTEICEGPFYH--VFPLHKDSHMRSVMTEYIMIAQQAGLMNHWERETFWEAVHLHRIHVHLFDD 570
            |||.|.|..|.:  |..|.:.|.::......|.....||::.::.||  ::|....:....  |.
  Fly   509 RLTHIKEHIFLYQMVIYLRRHSLLKFAFDRKIKQLLSAGIIGYFVRE--FDACQYRKPFEE--DY 569

  Fly   571 EPMALSLDFFSSLLRTWTLGLILAGLAFAAEMKWHEHVTFKR 612
            |...:.||.|..|.....:.|..|.:||..|:.....|..:|
  Fly   570 EVTPIPLDSFCGLYYISLIWLSAAVVAFILELLSQRIVWLRR 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir56dNP_611432.1 ATPase-IIIA_H <312..422 CDD:273731 21/94 (22%)
Ir7aNP_572406.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.