DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56d and GRIK3

DIOPT Version :9

Sequence 1:NP_611432.1 Gene:Ir56d / 37252 FlyBaseID:FBgn0034458 Length:632 Species:Drosophila melanogaster
Sequence 2:NP_000822.2 Gene:GRIK3 / 2899 HGNCID:4581 Length:919 Species:Homo sapiens


Alignment Length:325 Identity:60/325 - (18%)
Similarity:112/325 - (34%) Gaps:112/325 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 VNKTGVWQAEEFFH--KYAKNMKG----------YLVRTPILYDMPRVF-KSDRP---TNRYE-- 238
            :.|.|||...:..:  :.||. :|          .|:.|.:|.:...:| ||||.   .:|:|  
Human   402 LEKVGVWSPADGLNITEVAKG-RGPNVTDSLTNRSLIVTTVLEEPFVMFRKSDRTLYGNDRFEGY 465

  Fly   239 -----KNFIHGTSGNLFLGFLEFVNAT--------------------LMDTSANVTADYLNMTNL 278
                 |...|      .|||...:...                    |:|..|::....|.:|::
Human   466 CIDLLKELAH------ILGFSYEIRLVEDGKYGAQDDKGQWNGMVKELIDHKADLAVAPLTITHV 524

  Fly   279 LD--------LVSQGVYETLIHSFTEITTKFVVSYSYP-------------IGINDCCIMVPYRN 322
            .:        .::.||  ::::.....|...|.|:..|             :|::  |::.....
Human   525 REKAIDFSKPFMTLGV--SILYRKPNGTNPSVFSFLNPLSPDIWMYVLLAYLGVS--CVLFVIAR 585

  Fly   323 QSPADQY-MH-----EALQENVWVLISLFTLYITVAIYLCSPLRPRDLSAAFLQSICTLTYSVPT 381
            .||.:.| .|     ..:.||.:.|::.|...:...:...|.|.|:.||...:..|.        
Human   586 FSPYEWYDAHPCNPGSEVVENNFTLLNSFWFGMGSLMQQGSELMPKALSTRIIGGIW-------- 642

  Fly   382 FIIRTPTLRMRYLYILLAIWGIVTSNLYISRMTSYFTTAPPVRQINTVQDVVEANLRIKMLAIEY 446
                       :.:.|:    |::|  |.:.:.::.|.......|::..|:.      |...|||
Human   643 -----------WFFTLI----IISS--YTANLAAFLTVERMESPIDSADDLA------KQTKIEY 684

  Fly   447  446
            Human   685  684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir56dNP_611432.1 ATPase-IIIA_H <312..422 CDD:273731 20/115 (17%)
GRIK3NP_000822.2 PBP1_iGluR_Kainate_GluR5_7 34..417 CDD:107388 4/14 (29%)
ANF_receptor 55..398 CDD:279440
PBP2_iGluR_Kainate_GluR7 433..801 CDD:270441 53/293 (18%)
Lig_chan 564..832 CDD:278489 27/154 (18%)
Glutamate binding. /evidence=ECO:0000250 690..692
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.