DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56c and Ir7a

DIOPT Version :9

Sequence 1:NP_611431.1 Gene:Ir56c / 37251 FlyBaseID:FBgn0034457 Length:567 Species:Drosophila melanogaster
Sequence 2:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster


Alignment Length:315 Identity:65/315 - (20%)
Similarity:110/315 - (34%) Gaps:93/315 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 PFDWNVWFFALGALLALVLLELMWLRMFGGWSGYRGAVLNSFCYIINVPIEGQ-LQQPCLLRFLL 356
            ||...||...:.:.|.|||:..|..|:..|.|......|.....::..|:|.: |.:...||.| 
  Fly   343 PFTVIVWLALVVSSLLLVLVLWMRNRLVCGRSDLASHALQVLTTLMGNPLEARSLPRSSRLRIL- 406

  Fly   357 LATVFFHGFFLSAYYTSNLGSILTV----NLFHAQINTMNDIVSAQLPVMIIDYEMEFLLNLNKE 417
                 :.|:.|       |..:|.|    .||.:                       |.|..:|.
  Fly   407 -----YAGWLL-------LVLVLRVVYQGKLFDS-----------------------FRLPYHKP 436

  Fly   418 LPQEFLELLR--------------PVDSAVFSEH-------------------QTSFNSSFAYFV 449
            ||.|..||:|              |.:..|.:.:                   .||..::..|: 
  Fly   437 LPTEISELIRSNYTLINQEYLDYYPRELTVLTRNGSKDRFDYIQGLGKEGKFTTTSLIATMEYY- 500

  Fly   450 TEDHWEFLDEQQKHLKQRLFKLSSICFGSYHLAFPLQMDSSLWRDIEYFTFRIHSSGLLNFYARS 514
            ...||.  ..:..|:|:.:|....:.:...|.......|    |.|:    ::.|:|::.::.| 
  Fly   501 NMMHWS--TSRLTHIKEHIFLYQMVIYLRRHSLLKFAFD----RKIK----QLLSAGIIGYFVR- 554

  Fly   515 SFGSALHAGLVQRMPDTQEY--TSAGLQHLAIAFILLLVMSFLAGIVFVLETLSR 567
            .|.:..:     |.|..::|  |...|......:.:.|:....|.:.|:||.||:
  Fly   555 EFDACQY-----RKPFEEDYEVTPIPLDSFCGLYYISLIWLSAAVVAFILELLSQ 604



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.