DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56b and Ir75b

DIOPT Version :9

Sequence 1:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001137966.2 Gene:Ir75b / 8673994 FlyBaseID:FBgn0261402 Length:605 Species:Drosophila melanogaster


Alignment Length:348 Identity:59/348 - (16%)
Similarity:110/348 - (31%) Gaps:95/348 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 PEETSDFFNATQHSYPLE---LMTNCVMVPLAPELPKWMYMVWPLGKYIWTCLFLGTFYVALLLR 150
            |...|...:||:...|..   .:|..:::.||                  .||...||   :|.|
  Fly   304 PRSVSAGLSATEFLQPFSGGVWLTFALLLLLA------------------GCLLWVTF---ILER 347

  Fly   151 YVHWREPGNATRSYTRNVLHAMALLMFSANMNMSVKLKHASIRVIIFYTLLYIFGFILTNYHLSH 215
            ...|:..           |....||.|.|.......|...|:...:.:..|.:..:::.||:.|.
  Fly   348 RKQWKPS-----------LLTSCLLSFGAGCIQGAWLTPRSMGGRMAFFALMVTSYLMYNYYTSI 401

  Fly   216 MTAFDMKPVFLRPIDTWSDLIHSRL----------RIVIHDSLLEELR----------------- 253
            :.:..:.......|.|...|..|.|          ||.:..|...::|                 
  Fly   402 VVSKLLGQPIKSNIRTLQQLADSNLDVGIEPTVYTRIYVETSEEPDVRDLYRKKVLGSKRSPDKI 466

  Fly   254 WLPVYQALLA-SPSRSYAYVVTQDAWLFFNRQQKVLIQPYFHLSKVCFGGLFNALP--------- 308
            |:|....:|: .....:.|:........|       ::.:|...::|   ..|.:|         
  Fly   467 WIPTEAGVLSVRDQEGFVYITGVATGYEF-------VRKHFLAHQIC---ELNEIPLRDASHTHT 521

  Fly   309 -MASNASFADSLNKFILNVWQAGLWNYWEELAFRYAEQAGYAKVFLDTYP---VEPLNLEFFTTA 369
             :|..:.:|:.:....|.:.:.|:         .:..:..:.:..|..|.   ...:.||:....
  Fly   522 VLAKRSPYAELIKLSELRMLETGV---------HFKHERSWMETKLHCYQHNHTVAVGLEYAAPL 577

  Fly   370 WIVLSAGIPISSLAFCLELFIHR 392
            :|:|...|.:......||:..||
  Fly   578 FIILLGAIILCMGILGLEVIWHR 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir56bNP_611430.1 None
Ir75bNP_001137966.2 Periplasmic_Binding_Protein_Type_2 253..553 CDD:304360 48/299 (16%)
Lig_chan 343..585 CDD:278489 43/274 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.