DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56b and Ir94d

DIOPT Version :9

Sequence 1:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001138099.1 Gene:Ir94d / 7354412 FlyBaseID:FBgn0259193 Length:593 Species:Drosophila melanogaster


Alignment Length:436 Identity:89/436 - (20%)
Similarity:180/436 - (41%) Gaps:106/436 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YSFDIPHAFIFNETQFVVPK-------FCGPYMEIVKHFAEVYHYQLFLDSLESLP-KKSVVE-- 70
            :.:::|.|...:..:.:|.:       |.||....:|.|.:.|:.:|    ::..| .:|.:.  
  Fly   179 HGYEVPIALGGSSPRLIVYRDLEGKLIFSGPVGNFMKSFEQRYNCRL----VQPYPFDESAISPA 239

  Fly    71 QDIISGKYNLSLHGVI--IRPEETSDFFNATQHSYPLELMTNCVMVPLAPELP-KWMYMVWPLGK 132
            :|:|:...|.|:...:  |.|:     ...|.:|||:|||:.|:|:|:..|:| ..:|.:     
  Fly   240 RDLIASVQNGSVQIALGAIYPQ-----VPYTGYSYPIELMSWCLMMPVPEEVPHSQLYSM----- 294

  Fly   133 YIWTCLFLGTFYVALLLRYVHWREPGNATRSYTRNVLHAMALLMFSANMNMSVKLKHAS-IRVII 196
             :::.:..|...||::|                .::..:|||.:....::.|....|.| :|.::
  Fly   295 -VFSPMAFGITIVAMVL----------------ISLTLSMALRLHGYRVSFSEYFLHDSCLRGVL 342

  Fly   197 ----------------FYTLLYIFGFILTNYHLSHMTAFDMKPVFLRPIDTWSDLIHSRLRIVIH 245
                            .|.::.:.|.::|:::.|:.:.|.........:.::..:.||.::||| 
  Fly   343 SQSFYEVLRAPALIKAMYLVICLLGLLITSWYNSYFSTFVTSAPRFPQLTSYESIRHSNIKIVI- 406

  Fly   246 DSLLEELRWLPVYQALL--------------------------ASPSRSYAYVVTQDAWLFFNRQ 284
                    |.|.|:.||                          .|....|.|::..:.|.....|
  Fly   407 --------WKPEYEMLLFFSENMEKYSSIFQLQEDYKEFLHLRDSFDTRYGYMMPMEKWSLMKEQ 463

  Fly   285 QKVLIQPYFHL-SKVCFGGLFNAL----PMASNASFADSLNKFILNVWQAGLWNYWEELAFRYAE 344
            |:|...|.|.| ..:|   :|:.:    ||..|:.|.:..::.||:|...||.:.|.:::|....
  Fly   464 QRVFSSPLFSLQDDLC---VFHTVPIVFPMVKNSIFKEPFDRLILDVTATGLLSRWRDMSFTEMI 525

  Fly   345 QAGYAKVFLDTYPVE--PLNLEFFTTAWIVLSAGIPISSLAFCLEL 388
            :||...:....:|.|  .:.:......|..:...:.::::.|.|||
  Fly   526 KAGQLGLEDRGHPKEFRAMKVGDLIQIWRFVGWMLGLATIVFLLEL 571



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.