DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56b and Ir94g

DIOPT Version :9

Sequence 1:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_651147.2 Gene:Ir94g / 42768 FlyBaseID:FBgn0039079 Length:545 Species:Drosophila melanogaster


Alignment Length:433 Identity:89/433 - (20%)
Similarity:165/433 - (38%) Gaps:116/433 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DLASGVIRSPYSFDIPHAFIFNETQFVVPKFCGPYMEIVKHFAEVYHYQL-------------FL 57
            :|..||||:...:..|:..::.:.: ...:..|...::::.:|..::.||             |:
  Fly   172 NLRGGVIRTMPDYSEPNTILYQDKE-GNKEILGYLWDLLEAYAHKHNAQLQVVNKYADDRPLNFI 235

  Fly    58 DSLESLPKKSVVEQDIISGKYNLSLHGVIIRPEETSDFFNATQHSYPLELMTNCVMVPLAPEL-- 120
            :.|::      .:..||.       .|..|:|..........:.|||:...:.|.|:|:..:|  
  Fly   236 ELLDA------AQSGIID-------VGASIQPMSMGSLSRMHEMSYPVNQASWCTMLPVERQLHV 287

  Fly   121 PKWMYMVWPLGKYIWTCLFLGTFYVALLLRYVHWREPGNATRSYTRNVLHAMALLMFSANMNMSV 185
            .:.:..|.|. ..:...|.|..||..|..|   ||                              
  Fly   288 SELLTRVIPY-PTLALLLLLWIFYEVLRGR---WR------------------------------ 318

  Fly   186 KLKHASIRVIIFYTLLYIFGFILTNYHLSHMTAFDMKPVFLRPIDTWSDLIHSRLRIV------- 243
              :|:.::.|.:..|..:   :.:||....:..| ..|..|.|:::.:.|:.|.:||:       
  Fly   319 --RHSRLQSIGWLVLATL---VSSNYVGKLLNLF-TDPPSLPPVNSLAALMESPVRIISIRSEYS 377

  Fly   244 -----------------IHDSLLEELRWLPVYQALLASPSRSYAYVVTQDAWLFFNRQQKVLIQP 291
                             :|.|:|..||         .:.:.||.|.:|.:.|..:..|||...:|
  Fly   378 AIEFTQRTKYSAAFHLALHASILIGLR---------NAFNTSYGYTITSEKWKIYEEQQKRSSKP 433

  Fly   292 YFHLSK-VCFGGLFNALP----MASNASFADSLNKFILNVWQAGLWNYWEELAFRYAEQAGYAKV 351
            .|..|| :||   :..:|    :..|:.....|:.:.|.:.||||.::|....|.|..:||  |:
  Fly   434 VFRYSKDLCF---YEMIPFGLVIPENSPHRAPLHSYTLLLRQAGLHDFWVNRGFSYMVKAG--KI 493

  Fly   352 FL----DTYPVEPLNLEFFTTAWIVLSAGIPISSLAFCLELFI 390
            ..    :.|..:.|.:......:|:..:.:.||.:.|..|||:
  Fly   494 NFTAVGERYEAKTLTITDLRNVFIIYVSVLLISLILFTCELFV 536



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.