DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56b and Ir87a

DIOPT Version :9

Sequence 1:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster


Alignment Length:420 Identity:76/420 - (18%)
Similarity:150/420 - (35%) Gaps:108/420 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KFCGPYMEIVKHFAEVYH------------YQLFLDSLESLPKKSVVEQDIISGKYNLSLHGVII 87
            |..|...|:|:..||..|            |.||              |.:|.|:..:.:.|:..
  Fly   408 KLSGIEYEMVQTIAERLHVSIEMQGENSNLYHLF--------------QQLIDGEIEMIVGGIDE 458

  Fly    88 RPEETSDFFNATQHSYPLELMTNCVMVPLAPELPKWMYMVWPLGKYIWTCLF-------LGTFYV 145
            .|..:.  |.::...|..:.:|.||.......           |.:.:...|       :|.|.|
  Fly   459 DPSISQ--FVSSSIPYHQDELTWCVARAKRRH-----------GFFNFVATFNADAGFLIGIFVV 510

  Fly   146 ALLLRYVHW---REPGNATRS---YTRNVLHAMALLMFSANMNMSVKLKHASIRVIIFYTLLYIF 204
            ...|  |.|   |..|...|:   |....|..:.:|     :|.::..:...|.:...:.|.::.
  Fly   511 TCSL--VVWLAQRVSGFQLRNLNGYFPTCLRVLGIL-----LNQAIPAQDFPITLRQLFALSFLM 568

  Fly   205 GFILTNYHLSHMTAFDMKPVFLRPIDTWSDLIHSRLRIV------------------IHD----- 246
            ||..:|.:.|.:.:....|.....|.|..::..:::.::                  |.:     
  Fly   569 GFFFSNTYQSFLISTLTTPRSSYQIHTLQEIYSNKMTVMGTSEHVRHLNKDGEIFKYIREKFQMC 633

  Fly   247 -SLLEELRWLPVYQALLASPSRSYAYV---VTQDAWLFFNRQQKVLIQPYFHLSKVCFGGLFNAL 307
             :|::.|......:.:..:.||.:::.   :.:|....|:|::.:    |.:|..:.....::.|
  Fly   634 YNLVDCLNDAAQNEHIAVAVSRQHSFYNPRIQRDRLYCFDRRESL----YVYLVTMLLPKKYHLL 694

  Fly   308 PMASNASFADSLNKFILNVWQAGLWNYW-EELAFRYAEQAGYAKVFLDTYPVEPLNLEFFTTAWI 371
                     ..:|..|.::.::|....| .:|..|........:|..|  |.:.|..:.|..| |
  Fly   695 ---------HQINPVIQHIIESGHMQKWARDLDMRRMIHEEITRVRED--PFKALTFDQFRGA-I 747

  Fly   372 VLSAG-IPISSLAFCLEL----FIHRRKQR 396
            ..|.| :.::|..|..||    :::|.::|
  Fly   748 AFSGGLLLVASCVFAFELCYVKYVYRTEKR 777

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir56bNP_611430.1 None
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 17/82 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.