DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56b and Ir76a

DIOPT Version :9

Sequence 1:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001097647.3 Gene:Ir76a / 40157 FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster


Alignment Length:453 Identity:96/453 - (21%)
Similarity:160/453 - (35%) Gaps:111/453 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLDTDLASGVIRSPYSFDIPHAFIFNETQFVVPKFCGPYMEIVKHFAEVYHYQLFLDSLESLPK 65
            ||||.:      :.|..:|    ...|.|...:.   |..::::..|.|:|:..:.:|:.|... 
  Fly   237 MLLDYE------KPPLYYD----RFMNTTDVTID---GTDIQLMLIFCELYNCTIQVDTSEPYD- 287

  Fly    66 KSVVEQDIISGKYNLSLHGVIIRPEETSDF----FNATQHSYPLELMTNCV-------MVPLAPE 119
                ..||........|.|:|:  :..:|:    ......:|....||:.:       :||....
  Fly   288 ----WGDIYLNASGYGLVGMIL--DRRNDYGVGGMYLWYEAYEYMDMTHFLGRSGVTCLVPAPNR 346

  Fly   120 LPKWMYMVWPLGKYIWTCLFLGTFYVALLL----RYVHWR-EPGNATRSYTRNVLHAMALLMFSA 179
            |..|..::.|....:|.|:.|.....:|.|    |:.|.. ..||:..|..|  ...::.|....
  Fly   347 LISWTLLLRPFQFVLWMCVMLCLLLESLALGITRRWEHSSVAAGNSWISSLR--FGCISTLKLFV 409

  Fly   180 NMNMSVKLKHASIRVIIFYTLLYIFGFILTNYHLSHMTA-----------------FDMKPVFLR 227
            |.:.:......::|.::..:  |:...|||..:...:.|                 ||.|.::..
  Fly   410 NQSTNYVTSSYALRTVLVAS--YMIDIILTTVYSGGLAAILTLPTLEEAADSRQRLFDHKLIWTG 472

  Fly   228 PIDTWSDLIHSRLRIVIHDSLLEELRWLPVYQALLASPSRSYAYVVTQDAWLFFNRQQKVLIQPY 292
            ....|...|..|....:...|:|..|   ||.|.|.|     |:..|:              |..
  Fly   473 TSQAWITTIDERSADPVLLGLMEHYR---VYDANLIS-----AFSHTE--------------QMG 515

  Fly   293 FHLSKVCFGGLFN-------ALP----MASNASFA-------------DSLNKFILNVWQAGLWN 333
            |.:.::.||.|.|       ||.    |..:..||             ::.|.|||....:|...
  Fly   516 FVVERLQFGHLGNTELIENDALKRLKLMVDDIYFAFTVAFVPRLWPHLNAYNDFILAWHSSGFDK 580

  Fly   334 YWE-ELAFRYAEQ------AGYAKVFLDTYPVEPLNLEFFTTAWIVLSAGIPISSLAFCLELF 389
            :|| ::|..|...      ....|..||..||: |.::.|....::...|:..|.|.|..||:
  Fly   581 FWEWKIAAEYMNAHRQNRIVASEKTNLDIGPVK-LGIDNFIGLILLWCFGMICSLLTFLGELW 642



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.