DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56b and Ir68b

DIOPT Version :9

Sequence 1:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster


Alignment Length:473 Identity:90/473 - (19%)
Similarity:168/473 - (35%) Gaps:117/473 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 YSFDIPHAFIFNETQFVVPKFCG--PYMEIVKHF-AEVYHYQLFLDSLESLPKKSV--------- 68
            :.||   .|.:...| |:.:..|  ||...||.. .....:.:|.|.|.::|:..|         
  Fly   159 FDFD---PFAWGGLQ-VIQRLDGEVPYARKVKDLRGYPLRFSMFTDPLMAMPRSPVETAGYQAVD 219

  Fly    69 -VEQDIISGKYNLSLHGVIIRPEE----------------TSDFFNATQHSYP-LELMTNCV--- 112
             |...::....|.|:  ..:.||:                .||......|..| ...:.:|:   
  Fly   220 GVAARVVGEMLNASV--TYVFPEDNESYGRCLPNGNYTGVVSDIVGGHTHFAPNSRFVLDCIWPA 282

  Fly   113 --------------MVPLAPELPKWMYMVWPLGKYIWTCLFLGTFYVALLLRYVHWREPGNATRS 163
                          :||.:...|:::..|....:.:| .|.|.|..|.:|:.:|..|......| 
  Fly   283 VEVLYPYTRRNLHLVVPASAIQPEYLIFVRVFRRTVW-YLLLVTLLVVVLVFWVMQRLQRRIPR- 345

  Fly   164 YTRNVLHAMALLMFSANMNMSVKLKHASIRVIIFYTL-LYIFGFILTNYHLSHMTAFDMKPVFLR 227
              |.|:...|.......|.....:...:.|:..|.:: .::.|:||.:|.||.:....::..|:|
  Fly   346 --RGVIQFQATWYEILEMFGKTHVGEPAGRLSSFSSMRTFLMGWILFSYVLSTIYFAKLESGFVR 408

  Fly   228 P-----IDTWSDLIHSRLRI----VIHDSLLEEL------------RWLPV------YQALLASP 265
            |     :|...||:|..:.|    .::|::...|            |.||:      ||.::...
  Fly   409 PSYEEQVDRVDDLVHLDVHIYAVTTMYDAVRSALTEHQYGLLENRSRQLPLGIATSYYQPVVRRR 473

  Fly   266 SRSYAYVVTQDAWLFFNRQQKVLI-------QPYFHLSKVCFGGLFNALPMASNASFADSLNKFI 323
            .|..|:::..     |:.:..:.|       :|.:|:::.....:.....:...:.|...|....
  Fly   474 DRRAAFIMRD-----FHARDFLAITYDSQAERPAYHIAREYLRSMICTYILPRGSPFLHRLESLY 533

  Fly   324 LNVWQAGLWNYW-------------------EELAFRYAEQAGYAKVFLDTYPVEPLNLEFFTTA 369
            ....:.|.:.:|                   |:|..:....:|..::.:....| .|.|:....|
  Fly   534 SGFLEHGFFEHWRQMDLITRVGASPDAEEFLEDLGDQTDTDSGSNELAIRNKKV-VLTLDILQGA 597

  Fly   370 WIVLSAGIPISSLAFCLE 387
            :.:.|.||.||.|.|.:|
  Fly   598 FYLWSVGIGISCLGFAVE 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir56bNP_611430.1 None
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 50/282 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.