DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56b and Ir68a

DIOPT Version :9

Sequence 1:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_648455.2 Gene:Ir68a / 39269 FlyBaseID:FBgn0036150 Length:704 Species:Drosophila melanogaster


Alignment Length:430 Identity:79/430 - (18%)
Similarity:155/430 - (36%) Gaps:116/430 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IRSPYSFD-----IPHAFIFNETQ-FVVPKFCGPYMEIVKHFAEVYHYQLFLDSLESLPKKSVVE 70
            :.:|::|:     .|.:...|..| |::|...|.::.::        ..||:             
  Fly   334 LSAPHNFECLTFLTPESSTDNSWQTFILPFSAGMWVGVL--------LSLFV------------- 377

  Fly    71 QDIISGKYNLSLHGVIIRPEETSDFFNATQHSYPLELMTNCVM----VPLAPELPKWMYMVWPLG 131
              :.:..|.:|....||....:|:||             .|:.    ||:.|::.:.:       
  Fly   378 --VGTVFYAISFLNAIINGNVSSEFF-------------RCLRPNRNVPMDPKIYRRI------- 420

  Fly   132 KYIWTCLFLGTFYVALLLRYVHW---REPGNATRSYTRNVLHAMALLMFSANMNMSVKLKHASIR 193
                      :|.:| :.||...   |.|.:....||..:|...::|::.|...|.   ::..:|
  Fly   421 ----------SFRIA-ISRYRSSKGDRMPRDLFDGYTNCILLTYSMLLYVALPRMP---RNWPLR 471

  Fly   194 VIIFYTLLYIFGFILTNYHLSHMTAFDMKPVFLRPIDTWSDLIHSRLR------------IVIHD 246
            |:..:..:|.. .::..|..| .||....|.....|||..||:.|.:.            :..:|
  Fly   472 VLTGWYWIYCI-LLVATYRAS-FTAILANPAARVTIDTLEDLLRSHIPPSTGATENRQFFLEAND 534

  Fly   247 SLL----EELRWLPVYQALLASPSRSY-AYVVTQDAWLFFNRQQKVLIQ--PYFHLSKVCFGGLF 304
            .:.    |::........|.:..::.. ||...:    |:.|..:|..:  ...|:.|.|...:.
  Fly   535 EVARKVGEKMEVFGYSDDLTSRIAKGQCAYYDNE----FYLRYLRVADESGSALHIMKECVLYMP 595

  Fly   305 NALPMASNASFADSLNKFILNVWQAGLWNYWEELAFRYAEQAGYAKVFLDTYPVEPL-------N 362
            ..|.|..|::....::..|.::.:.||...|             .|..::..|.|.|       |
  Fly   596 VVLAMEKNSALKPRVDASIQHLAEGGLIAKW-------------LKDAIEHLPAEALAQQEALMN 647

  Fly   363 LEFFTTAWIVLSAGIPISSLAFCLELFIHRR-KQRRPQYE 401
            ::.|.::::.|..|..||.|....|.:..:. ..:.|.|:
  Fly   648 IQKFWSSFVALLIGYVISMLTLLAERWHFKHIVMKHPMYD 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir56bNP_611430.1 None
Ir68aNP_648455.2 Lig_chan 429..661 CDD:278489 48/253 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.