DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56b and Ir67a

DIOPT Version :9

Sequence 1:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_648329.3 Gene:Ir67a / 39110 FlyBaseID:FBgn0036010 Length:584 Species:Drosophila melanogaster


Alignment Length:451 Identity:87/451 - (19%)
Similarity:166/451 - (36%) Gaps:104/451 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VIRSPYSFDIPHAFIFNETQFVVPKFCGPYMEIVKHFAEVYHYQLFLDSLESLPKKSVVEQDIIS 75
            ::..|..|. |.:.::...:....:..|...:.:..|..:|::....            ::.|:.
  Fly   174 IVTLPDQFP-PRSIVYRNPKTDEIQMTGYVYKFLLEFIRIYNFTFRW------------QRPIVQ 225

  Fly    76 GK-------YNLSLHGVI---------IRPEETSDFFNATQHSYPLELMTNCVMVPLAPELP-KW 123
            |:       .|::|:|.|         ..|.|...|.:.    |.:|..  .:|||.|.|:. ..
  Fly   226 GERMNLILLRNMTLNGTINLAISLCGFETPSELGVFSDV----YDMEEW--YIMVPRAQEISIAD 284

  Fly   124 MYMVWPLGKYIWTCL-------FLGTFYVALLLR-YVHWRE--------PGNATRSYTRNVLHAM 172
            :|:|...|.::...:       .|.|.:..|||: .|.|..        .|...:|:.       
  Fly   285 VYVVMVSGNFLIVLIIFYFIFTILDTCFGPLLLKERVDWSNLMLNERMISGIMGQSFN------- 342

  Fly   173 ALLMFSANMNMSVKLKHASIRVIIFYTLLYIFGFILTNYHLSHMTAFDMKPVFLRPIDTWSDLIH 237
                .||...:|.|:.:|:         |::.|.:|:..:.:|:.....|....:.|..:..|..
  Fly   343 ----MSARNTISSKVTNAT---------LFLLGLVLSTLYAAHLKTLLTKRPTSQQISNFKQLRD 394

  Fly   238 SRLRIVIHDS---------------LLEELRWLPV--YQALLASPSRSYAYVVTQDAWLFFNRQQ 285
            |.:.:...::               :.::|.:...  |.||....:||.|:......|:...::|
  Fly   395 SPVTVFFEEAERFYLKHAWDRPIRYIKDQLNFRETIEYNALRMGLNRSNAFSALTSEWMIVAKRQ 459

  Fly   286 KVLIQPYFHLS---KVCFGGLFNALPMASNASFADSLNKFILNVWQAGLWNYWEELAFRYAEQAG 347
            ::..||.|.:.   :|....:..:|.|.||:.:.|.:|..|..|..||:..||:....|.....|
  Fly   460 ELFKQPIFTVQPELRVIQTSVLLSLVMQSNSIYEDHINDLIHRVQSAGIVEYWKHQTLREMITMG 524

  Fly   348 YAKVFLDTYPVEPLNLEF----FTTAWIVLSAGIPISSLAFCLEL----FIHRR--KQRRP 398
            .... .|.:|..... ||    ....|::..:.:.:|.:.|..||    ||.:.  :.:||
  Fly   525 MISQ-KDPFPYVAFR-EFKVGDLFWIWLLWVSFLFMSFVIFLCELLVDCFISKTLIRNKRP 583



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.