DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56b and Ir62a

DIOPT Version :9

Sequence 1:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001033986.1 Gene:Ir62a / 3885628 FlyBaseID:FBgn0053971 Length:606 Species:Drosophila melanogaster


Alignment Length:447 Identity:105/447 - (23%)
Similarity:181/447 - (40%) Gaps:104/447 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IRSPYSFDIPHAFIFNETQFVVPKFCGPYMEIVKHFAEVYHYQLFLDSL------ESLPKKSVVE 70
            :|.|...|:|:.|.:...:....:..|....::...  :.|..:.:|..      .||...:.:.
  Fly   204 MRLPVQQDVPNTFWYKNRRTKAWELAGLGGILINQL--MMHLNVTMDLFRFEVNGSSLLNMAALT 266

  Fly    71 QDIISGKYNLSLHGVIIRPEETSDFFNATQHSYPLELMTNCVMVPLAPELPKWMYMVWPLGKYIW 135
            ..|:.||..||.|........||     ..:|||.::...|.|:||..|:.:.:|:..|....:|
  Fly   267 DLIVKGKVELSPHLYDTLQSNTS-----VDYSYPTQVAPRCFMIPLDNEISRSLYVFLPFSLTMW 326

  Fly   136 TCLFLGTFYVALLLRYVHWREPGNATRSYTRNVL---HAMALLMFSANMNMSVKLKHASIR-VII 196
            .||    .:|.|::.:|           |.|.::   |..|:|    .:..:.::::.:.: |..
  Fly   327 LCL----LFVLLVVHFV-----------YVRRLIPDGHFWAIL----GVPGAGQVRYGNRKPVRR 372

  Fly   197 FYTLLYIFG-FILTNYHLSHMTAFDMKPVFLRPIDTWSDLIHSRLRIVIHDSLLEELRWLPVYQA 260
            |.|.|.:|| |||...:.:.:|:.....:..||                 |:.||||..|| |: 
  Fly   373 FSTFLILFGIFILGQTYSTKLTSSLTVTLIRRP-----------------DNSLEELFLLP-YR- 418

  Fly   261 LLASPSRSYA-----------------------------------YVVTQDAWLFFNRQQKVLIQ 290
            :|..|:..||                                   |.::...|.||:.||:.|.:
  Fly   419 ILVLPTDVYAIVDSLGHAEQFSTKFSCTDAENFSQKRISMHPEYIYPISTIRWRFFDMQQRFLRK 483

  Fly   291 PYFHLSKVCFGGLFNALPMASNASFADSLNKFILNVWQAGLWNYWEELAFRYAEQAGYAKVFLDT 355
            ..|:.||:|.|.......:..::...|:|::|:|:|.||||.:.|.:..:|.|.:.||.|.|...
  Fly   484 KRFYFSKICHGSFPYQYQLRVDSHLKDALHRFLLHVQQAGLHDLWLDTCYRKAHRMGYLKDFSTL 548

  Fly   356 YPVE------PLNLEFFTTAWIVLSAGIPISSLAFCLELFIHRR----KQRRPQYER 402
            ..:|      ||.|.....|:.:...|:..|.:||.:|:   |.    :|:.|...|
  Fly   549 AELEEKLRLRPLALNLLVPAFSLFLCGMLGSGIAFLVEI---RHSFGCRQKPPSINR 602



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CJJD
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.