DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56b and Ir52d

DIOPT Version :9

Sequence 1:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_611042.2 Gene:Ir52d / 36716 FlyBaseID:FBgn0050464 Length:594 Species:Drosophila melanogaster


Alignment Length:429 Identity:98/429 - (22%)
Similarity:171/429 - (39%) Gaps:87/429 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GVIRSPYSFD-IPHAFIFNETQFVVPKFCGPYMEIVKHFAEVYHYQLFLD-SLESLPKKSVVEQD 72
            |.:....:|: ||.:..:.:.:....|..|....::.:|.|..:..|.:. .|....||      
  Fly   183 GALLKSITFNLIPGSMAYRDPKTGQEKHIGYVANLLNNFVEKVNATLDMQVKLHKAGKK------ 241

  Fly    73 IISGKYNLSLHGVIIRPEETSD-------FFNATQH---SYPLELMTNCVMVPLAPELPK---WM 124
              :..||::...    .|:..|       :|..|..   |||..:.:.|.||||...:|.   :|
  Fly   242 --TSFYNITKWA----SEDLVDIGMSYAAYFEMTNFDTISYPYLMTSTCFMVPLPDMMPNSEIYM 300

  Fly   125 YMVWPLGKYIWTCLFLGTFYVALLLRYV---HWREPGNATRSYTRNVLHAMALLMFSAN-----M 181
            .:|.|....:...:|.   ..:::|.|:   .||     :.|....:|:.:.|..|.|.     .
  Fly   301 GIVDPPVLVVLIAIFC---IFSVMLNYIKQRSWR-----SLSLVNVLLNDICLRGFLAQPFPFPR 357

  Fly   182 NMSVKLKHASIRVIIFYTLLYIFGFILTNYHLSHMTAFDMKPVFLRPID----TWSDLIHSRLRI 242
            ..:.|||..|:       |:..|..|.|..:.|::.:|...|    |||    :::||.:||.::
  Fly   358 QSNRKLKLISM-------LVCFFSVITTTMYTSYLQSFMWGP----PIDPKMCSFADLENSRYKL 411

  Fly   243 VIHDSLLEELRWLPV-------------YQALLASPSRSYAYVVTQDAWLFFNRQQKVLIQPYFH 294
            .|....:|.||...|             .:.|..|...:|.|.::..:|..|..|||:...|.|:
  Fly   412 AIRRYDIEMLRPFNVSMDHVVVFDESSQLEYLRDSFDDNYMYPMSALSWSAFKEQQKLFAFPLFY 476

  Fly   295 LS-KVCFGGL-FNALPMASNASFADSLNKFILNVWQAGLWNYWEELAF------RYAEQAGYAKV 351
            .| |:|...: |.:.|:..:..:.|...:.:|...:.||..||.:.:|      :.|....::..
  Fly   477 YSEKLCLKPISFFSFPIRRHLPYRDLFEEHMLQQNEFGLSTYWIDRSFSDMVRLKLATMNDFSPP 541

  Fly   352 FLDTYPVEPLNLEFFTTAWI--VLSAGIPISSLAFCLEL 388
            .|:.|      :|....:|:  :...|:.||...|.|||
  Fly   542 RLEDY------IEVSDLSWVFGMYFTGLGISCCCFGLEL 574



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.