DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56b and Ir52a

DIOPT Version :9

Sequence 1:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_611041.2 Gene:Ir52a / 36715 FlyBaseID:FBgn0034023 Length:599 Species:Drosophila melanogaster


Alignment Length:425 Identity:93/425 - (21%)
Similarity:168/425 - (39%) Gaps:65/425 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DLASGVIRSPYSFDIPHAFIFNETQFVVPKFCGPYMEIVKHFAEVYHYQL-FLDSLESLPKK-SV 68
            ::....||:.....:|...::.:.:....|..|....::..:|:..:.:| |:|:.:...|| ||
  Fly   183 NMRGATIRTVADSLVPRTILYRDEKSGETKMMGYLGHMINTYAQKLNAKLHFIDTSKLGAKKPSV 247

  Fly    69 ------VEQDIISGKYNLSLHGVIIRPEETSDFFNATQHSYPLELMTNCVMVPLAPELP---KWM 124
                  |.:||:.....|:         .:..|.|.....||..|...|:|||:..::|   .:.
  Fly   248 LDIMNWVNEDIVDIGTALA---------SSLQFKNMDSVWYPYLLTGYCLMVPVPAKMPYNLVYS 303

  Fly   125 YMVWPLGK---YIWTCLFLGTFYVALLLRYVHWREPGNATRSYTRNVLHAMALLMFSANMNMSVK 186
            .:|.||..   ::..|||   ..:.:..:::.|:....|........|..:....|....|.|..
  Fly   304 MIVDPLVLSIIFVMLCLF---SVLIIYTQHLSWKNLTLANILLNDKSLRGLLGQSFPFPPNPSKH 365

  Fly   187 LKHASIRVIIFYTLLYIFGFILTNYHLSHMTAFDMKP--VFLR-----------------PIDTW 232
            ||      :|.:.|.:....|.|.|.....:.|...|  .::|                 .::..
  Fly   366 LK------LIIFVLCFASVMITTMYEAYLQSYFTQPPSEPYIRSFRDIGNSSLKMAISRLEVNVL 424

  Fly   233 SDLIHSRLRIVIHDSLL--EELRWLPVYQALLASPSRSYAYVVTQDAWLFFNRQQKVLIQPYFHL 295
            :.|.:|..|.:..|.||  ::   |..|..|..|.:.|:.:.|:.|.|..:..|||:..:|.|:|
  Fly   425 TSLNNSHFREISEDHLLIFDD---LSEYLVLRDSFNTSFIFPVSVDRWNGYEEQQKLFAEPAFYL 486

  Fly   296 -SKVCFGG--LFNALPMASNASFADSLNKFILNVWQAGLWNYWEELAFRYAEQAGYAKV-FLDTY 356
             :.:||..  ||:. |:.............::...:.||..:|:..:|....:.|.|.: .|...
  Fly   487 ATNLCFNQFMLFSP-PLRRYLPHRHLFEDHMMRQHEFGLVTFWKSQSFIEMVRLGLASMEDLSRK 550

  Fly   357 PVEPLNLEFFTTAWIV---LSAGIPISSLAFCLEL 388
            ..|.::|.....:||:   |.| :.|||..|.||:
  Fly   551 RNEEVSLLLDDISWILKLYLGA-MFISSFCFILEI 584



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.