DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56b and Ir94f

DIOPT Version :9

Sequence 1:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_732868.2 Gene:Ir94f / 318632 FlyBaseID:FBgn0051225 Length:558 Species:Drosophila melanogaster


Alignment Length:393 Identity:97/393 - (24%)
Similarity:151/393 - (38%) Gaps:91/393 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QFVVPKFCGPYMEIVKHFAEVYHYQLFLDSLESLPKKSVVEQDIISGKYNLSLH-GVIIRPEETS 93
            ||::        |..||....  .||   .:|..|:||:....|:....|.::. ...:||...:
  Fly   217 QFMI--------EFAKHINAT--LQL---PIEPHPEKSIKLVQILDLVRNQTVDIAASLRPYSLN 268

  Fly    94 DFFNATQHSYPLELMTN--CVMVPLAPELPKWMYMVWPLGKYIWTCLFLGTFYVALLLRYVHWRE 156
            ...::| |.|...:|..  |:|:|....:.....:. .|.|..||.|.|..||      .|| |.
  Fly   269 VQRSST-HIYGSPMMVGNWCMMLPTERVIGSHEALT-RLMKSPWTWLILLLFY------SVH-RF 324

  Fly   157 PGNATRSYTRNVLHAMALLMFSANMNMSVKLKHASIRVIIFYTL---LYIFGFILTNYHLSHMTA 218
            ....|| ...:::|.:.||     :|:|         :|.|...   .|..|....| |:|:|..
  Fly   325 LAQKTR-LRSSLIHLIKLL-----INLS---------LICFLQAQLSAYFIGPQKVN-HISNMQQ 373

  Fly   219 FD--------MKPVFLR-PIDTWSDLIHSRLRIVIHDSLLEELRWLPVYQALLASPSRSYAYVVT 274
            .:        |:..|:. |||..|....|   .::||...:    |..|:..|   :.||.|.||
  Fly   374 VEESGLKIRGMRGEFMEYPIDMRSRYASS---FLLHDLFFD----LAQYRNSL---NTSYGYTVT 428

  Fly   275 QDAWLFFNRQQKVLIQPYFHLS-KVCFG--GLFNALPMASNASFADSLNKFILNVWQAGLWNYWE 336
            ...|..:...|:...:|.|..| ::|..  .|| :|...||..:......|||.:.:|||...|.
  Fly   429 SVKWELYKEAQRHFRRPLFRYSEEICVQKLSLF-SLIQQSNCIYCYRSRIFILRMHEAGLIRLWY 492

  Fly   337 ELAFRYAEQAGYAKVFLDTYPV---------EPLNLEFFTTAW--IVL--SAGIPISSLAFCLEL 388
            ..::       |..|....:|:         :|:.    .|.|  :||  ..|:..|.:.|.:||
  Fly   493 RRSY-------YVMVTAGRFPIGDLSTVHRAQPIR----WTEWQNVVLLHGVGLLFSVVVFVIEL 546

  Fly   389 FIH 391
            .:|
  Fly   547 TVH 549



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.