DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56b and Ir94a

DIOPT Version :9

Sequence 1:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_732699.1 Gene:Ir94a / 318610 FlyBaseID:FBgn0051164 Length:595 Species:Drosophila melanogaster


Alignment Length:421 Identity:85/421 - (20%)
Similarity:169/421 - (40%) Gaps:64/421 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PYSFDIPHAFIFNETQFVVPKFCGPYMEIVKHFAEVYHYQLFLDSLESLPKKSVVEQ-DIISGKY 78
            |.:|   |..:.|.....:|.......|:...:|..|:..|      .:..:::.|. :|....|
  Fly   194 PINF---HGKVLNAIPNDIPILFVALNEMFTEYARRYNSTL------RIQNRTIKEDIEITEDNY 249

  Fly    79 NLSLHGVIIRPEETSDFFNATQHSYPLELMTNCVMVPLAPELPKWMYMVWPLGKYIWTCLFLGTF 143
            ::.:.   |:...:.:|.:....:..:...:..::||.|.|| :.:.:...||....|.|.| .|
  Fly   250 DIDMK---IQLHNSQNFLHHMNIAMDIGSNSLIILVPCATEL-RGLDIFKELGVRTLTWLAL-LF 309

  Fly   144 Y-----VALLLRYVHWREPG-NATRSYTRNVLHAMALLMFSANMN-----MSVKLKHASIRVIIF 197
            |     |.:|..::..|..| |.|..||..:::..|:.......:     .|:.::|       |
  Fly   310 YIIFVLVEMLFVFISNRFNGRNFTMRYTNPLINLRAVRAILGQTSPISNRYSLSIQH-------F 367

  Fly   198 YTLLYIFGFILTNYHLSHMTAFDMKPVFLRPIDTWSDLIHSRLRIVIHDS---LLEE-------- 251
            :..:.:||.:...:....:.:|..|..:...|:.:|:|..|.:.:|:..:   .:|:        
  Fly   368 FVFMSLFGTLFGGFFDCKLRSFLTKRPYYSQIENFSELRKSGVTVVVDHTTRQFIEQEINANFFR 432

  Fly   252 -----LRWLPVYQAL--LASPSRSYAYVVTQDAWLFFNRQQKVLIQPYFHLSKVCFGGLFNALPM 309
                 :|...:.:.:  :.|..|.:|:|.....|..|..:.|.:.|.....||..  .:...:|:
  Fly   433 DEVPNVRTTTIQELINHVYSYDRKFAFVANSIPWRTFREEMKSINQKILCDSKNL--TILENVPL 495

  Fly   310 A----SNASFADSLNKFILNVWQAGLWNYWEELAFRYAEQAGYAKVFL---DTYPVE-PLNLEFF 366
            .    .||.|:..|..||:|...:|:...|.::|.:...:  :.|..|   :..|.. ||:.:.|
  Fly   496 TFSIRRNAIFSHHLRNFIINAADSGMITCWFKMAGKVIRK--HIKTTLRESEQQPSHLPLSFDHF 558

  Fly   367 TTAWIVLSAGIPISSLAFCLELFIHRRKQRR 397
            ...|.||.....:|.:.|.:|: :..:.|||
  Fly   559 KWLWAVLCIAYVMSFMVFVMEI-LWSKYQRR 588



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.