DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56b and Ir7b

DIOPT Version :9

Sequence 1:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster


Alignment Length:432 Identity:82/432 - (18%)
Similarity:151/432 - (34%) Gaps:98/432 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FCGPYMEIVKHFAEVYHYQLFL------DSLESLPKKSVVEQDIISGKYNLSLHGVIIRPEETSD 94
            |.|....:::..||..::.:.|      :.|.:..:...:..:|.....:.||.|...:|...|:
  Fly   233 FVGIEGALLQFMAENLNFTVGLYWMNKEEVLATFDESGRIFDEIFGHHADFSLGGFHFKPSAGSE 297

  Fly    95 FFNATQHSY----PLELMTNCVMVPLAPELPKWMYMVWPLGKYIWTC----LFLGTFYVALLLRY 151
             ...:|.:|    .:.|:||     |......:..:.:|....:|..    |.|....:.||:|:
  Fly   298 -IPYSQSTYYFMSHIMLVTN-----LQSAYSAYEKLSFPFTPLLWRAIGLVLILACLLLMLLVRW 356

  Fly   152 VHWREPGNATRSYTRNVLHAMALLMFSANMNMSVKLKHASIRVIIFYTLLYIFG-FILTNYHLSH 215
            .|..|       ..||..:.:.:|....|:......:....|:::   |.::|. .:|.:.:.|.
  Fly   357 RHHHE-------LPRNPYYELLVLTMGGNLEDRWVPQRFPSRLVL---LTWLFATLVLRSGYQSG 411

  Fly   216 MTAFDMKPVFLRPIDTWSDLIHSRLRIVIHD--------SLLE------------ELRWLPVYQA 260
            |.....:.....|..|.|:::.....|.:.:        ||.|            ||:..|.   
  Fly   412 MYQLLRQDTQRNPPQTISEVLAQHFTIQLAEVNEARILASLPELRPEQLVYLEGSELQSFPA--- 473

  Fly   261 LLASPSRSYAYVVTQDAWLFFNRQQKV--------LIQPYFHLSKVCFGGLFNALPMASNASFAD 317
             ||..|.|.|.|.....:.:|...:||        |::...:..::.|       .:..::....
  Fly   474 -LAQQSGSSARVAILTPYEYFGYFRKVHPMSRRLHLVRERIYTQQLAF-------YVRRHSHLVG 530

  Fly   318 SLNKFILNVWQAGLWNYW-----------EELAFRYAEQAGYAKVFLDTYP----------VEPL 361
            .|||.|.:....|...:|           :|...|.|..:......:|..|          |.|:
  Fly   531 VLNKQIQHAHTHGFLEHWTRQYVSAVDEKDESVARIASTSYSTLDGIDGDPSLSESEEDQQVAPV 595

  Fly   362 N------LEFFTTAWIVLSAGIPISSLAFCLELFIHRRKQRR 397
            .      .|.....|::|.|.:. :.:.|.|||.:.|.|.|:
  Fly   596 RQNVLSMRELAALFWLILWANLG-AVVVFVLELLLPRIKLRK 636



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.