DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56b and Ir7a

DIOPT Version :9

Sequence 1:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_572406.1 Gene:Ir7a / 31686 FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster


Alignment Length:436 Identity:78/436 - (17%)
Similarity:152/436 - (34%) Gaps:126/436 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AFIFN----ETQFVVPKFCGPYMEIVKHFAEVYHYQLFLDSLESLPKKSVVEQDI---ISGKYN- 79
            :||.|    |.:..:.:..|...|::|..|.::.:::.|:.    |....:..||   .||.:: 
  Fly   230 SFIGNSSDPEERAQIWRLTGIDGELIKLLASIFDFRILLEE----PCNKCLSPDIKDDCSGCFDQ 290

  Fly    80 --LSLHGVII-----RPEETSDF-FNATQHSYPLELMTNCVMVPLAPELPKWMYMVWPLGKYIWT 136
              :|...::|     ..:..|.| |.::.|...|..:.:     ::.:......:..|....:|.
  Fly   291 VIISNSSILIGAMSGSHQHRSHFSFTSSYHQSSLVFIMH-----MSSQFGAVAQLAVPFTVIVWL 350

  Fly   137 CLFLGTFYVALLLRYVHWREPGNATRSYTRNVL---------HAMALLMFSANMNMSVKLKHASI 192
            .|.:.:..:.|:|              :.||.|         ||:.:|.......:..:....|.
  Fly   351 ALVVSSLLLVLVL--------------WMRNRLVCGRSDLASHALQVLTTLMGNPLEARSLPRSS 401

  Fly   193 RVIIFYTLLYIFGFILTNYHLSHMTAFDMKPVFLRPIDTWSDLIHSRLRIVIHDSLLEELRWLPV 257
            |:.|.|.     |::|.              |.:             ||:|....|.:..| ||.
  Fly   402 RLRILYA-----GWLLL--------------VLV-------------LRVVYQGKLFDSFR-LPY 433

  Fly   258 YQAL---LASPSRSYAYVVTQDAWLFFNRQQKVLIQ-----PYFHLSKVCFGGLFNALPMASNAS 314
            ::.|   ::...||...::.|:...::.|:..||.:     .:.::..:...|.|....:.:...
  Fly   434 HKPLPTEISELIRSNYTLINQEYLDYYPRELTVLTRNGSKDRFDYIQGLGKEGKFTTTSLIATME 498

  Fly   315 FAD----------------------------SLNKF-----ILNVWQAGLWNYWEELAFRYAEQA 346
            :.:                            ||.||     |..:..||:..|:    .|..:..
  Fly   499 YYNMMHWSTSRLTHIKEHIFLYQMVIYLRRHSLLKFAFDRKIKQLLSAGIIGYF----VREFDAC 559

  Fly   347 GYAKVFLDTYPVEPLNLEFFTTAWIVLSAGIPISSLAFCLELFIHR 392
            .|.|.|.:.|.|.|:.|:.|...:.:....:..:.:||.|||...|
  Fly   560 QYRKPFEEDYEVTPIPLDSFCGLYYISLIWLSAAVVAFILELLSQR 605



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.