DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56b and Ir52b

DIOPT Version :9

Sequence 1:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_725469.2 Gene:Ir52b / 246631 FlyBaseID:FBgn0050469 Length:596 Species:Drosophila melanogaster


Alignment Length:414 Identity:90/414 - (21%)
Similarity:169/414 - (40%) Gaps:63/414 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PHAFIFNETQFVVPKFCGPYMEIVKHFAEVYHYQLFLDSLESLPKKSVVEQDIISGKYNLSLHGV 85
            |...::.:......|..|....::.:||:..:..|.||.|:  |..|:.|...::....|.: |:
  Fly   194 PRVMLYQDANDGELKMIGYVANLITNFAQKVNATLQLDFLK--PSTSITEISRMAKDDELDM-GI 255

  Fly    86 IIRPEETSDFFNATQHSYPLELMTNCVMVPLAPELPKWMYMVWPLGKYIWTCLFLGTFYVALLL- 149
            .:  |.:.:..|....|||..|.:.|:||.:..:.|  ..:|:.|   |...|.||..:|..|| 
  Fly   256 TL--EASLNTSNLETSSYPYLLTSYCLMVQVPAKFP--YNLVYAL---IVDPLVLGIIFVLFLLL 313

  Fly   150 -------RYVHWREPGNATRSYTRNVLHAMALLMFSANMNMSVKLKHASIRVIIFYTLLYIFGFI 207
                   :.:.|::...|........|..:....|...:|.|.||:       :.:|:|.....:
  Fly   314 SVLLIYSQKMSWQDLSVANILLNDKSLRGLLGQSFPFPLNASKKLR-------LIFTILCFASIM 371

  Fly   208 LTNYHLSHMTAFDMKPVFLRPIDTWSDLIHSRLRIVI-----------HDSLLEELRW------- 254
            ||..:.:::.:|...|.....|.::.|:.....||.:           ::|...|:|.       
  Fly   372 LTTMYEAYLQSFFTNPPSEPEICSFQDVGSYNRRIAMSALEVNGLIKTNNSHFREIRMDDLEIFD 436

  Fly   255 -LPVYQALLASPSRSYAYVVTQDAWLFFNRQQKVLIQPYFHLSK-VCFGGL-FNALPMASNASFA 316
             :|....|..:.:.||.||||.|.|..:..||.:..:|.|:.:: :||..| |.::|:..:..:.
  Fly   437 NMPECYELRDAFNLSYNYVVTGDRWRSYAEQQTLFKEPVFYFARDLCFSRLIFLSVPLRRHLPYR 501

  Fly   317 DSLNKFILNVWQAGLWNYWEELAFRYAEQAGYAKVFLDTYPVEPLNLEFFTT--------AWI-- 371
            ...::.::...:.|..|||...:|       :..|.|....::.|:.....|        :||  
  Fly   502 HLFDEHMMQQHEFGFVNYWMSHSF-------FDMVRLGLTSLKDLSRPLAYTPSLLMDDISWIMK 559

  Fly   372 VLSAGIPISSLAFCLELFIHRRKQ 395
            :..|.|.:....|.||:.:.:.|:
  Fly   560 IYLAAIVLCVFCFLLEIGVDKWKR 583



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.