DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir56b and Ir52c

DIOPT Version :9

Sequence 1:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_725470.1 Gene:Ir52c / 246630 FlyBaseID:FBgn0050468 Length:599 Species:Drosophila melanogaster


Alignment Length:346 Identity:76/346 - (21%)
Similarity:138/346 - (39%) Gaps:46/346 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 TSDFFNATQHSYPLELMTNCVMVPLAPELP---KWMYMVWPLGKYIWTCLFLGTFYV-ALLLRYV 152
            |.:..|....|||..:.:.|.|.||...||   .:|.:|.|    ....:||..|.: ::|:.|:
  Fly   265 TLEMSNYDAISYPYLMSSYCFMAPLPDSLPFSDVYMAIVAP----SILIMFLIIFCICSVLIIYI 325

  Fly   153 HWREPGNAT-RSYTRNVLHAMALLM----FSANMNMSVKLKHASIRVIIFYTLLYIFGFILTNYH 212
            ..|...:.| ||...|.:.....|.    |....|..:||         .:.|:.....|.|..:
  Fly   326 QERSYRSLTIRSVLMNDICLRGFLAQPFPFPRQYNRKLKL---------IFMLVCFSSLISTTMY 381

  Fly   213 LSHMTAFDMKPVFLRPIDTWSDLIHSRLRIVIH-------DSLLEELRWLPVY-----QALLASP 265
            .:::.||...|.....:.::.|:..||..:.|:       ::|...|..:.:|     ..|.::.
  Fly   382 TAYLQAFLWGPPIEPRLTSFDDVKKSRYTMAINIYEREFLEALNVSLEDVEIYDYGKFSKLRSTF 446

  Fly   266 SRSYAYVVTQDAWLFFNRQQKVL-IQPYFHLSKVCFGGL-FNALPMASNASFADSLNKFILNVWQ 328
            :.:|.:.||...|...|.:||:. .:.:::....|.... ..::|:..:..:.|...:.:|...:
  Fly   447 NTNYLFPVTALQWFTINEEQKLFKYKIFYYCDAFCLNQFDILSIPLRRHLPYRDIFEEHMLLQKE 511

  Fly   329 AGLWNYWEELAFRYAEQAGYAKVFLDTYP------VEPLNLEFFTTAWIVLSAGIPISSLAFCLE 387
            .||..||.:.::|...:|... .|.|..|      :|..||.:..|.:.|   |:.:....|.||
  Fly   512 FGLTKYWIDQSYRDMIRANLT-TFKDFSPLLENDYIEVHNLYWVFTMYFV---GMGMGLCFFILE 572

  Fly   388 LFIHRRKQRRPQYERFECYDY 408
            :....|..|..:.:...||.:
  Fly   573 ILRPLRYWRNCKIKCEYCYAF 593



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.