DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11007 and AT5G11640

DIOPT Version :9

Sequence 1:NP_001286617.1 Gene:CG11007 / 37249 FlyBaseID:FBgn0034455 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_196725.1 Gene:AT5G11640 / 831036 AraportID:AT5G11640 Length:253 Species:Arabidopsis thaliana


Alignment Length:264 Identity:70/264 - (26%)
Similarity:116/264 - (43%) Gaps:51/264 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLAKPYYWVNILLAISYLLAKKT--QFICTRLFILAGEDEACDLDSREVE-ILFFLLI--VVMIR 68
            :::.|||:::.:...|||..:.:  .:...|||            .||:: .|.||:.  :.|:|
plant    15 IVSDPYYFLHFMAFFSYLPIRSSAAPYTSHRLF------------DREIQAFLAFLMFSAIKMVR 67

  Fly    69 SRKTGSVTMINYLASSFLYTKVANAILWAYADFRYGLGFLLLCVLVGMVLPEPSYRGPEHITYFR 133
            ..     |...::|.|.||.|:....:....|:|..:.|.::..::.::..:|::..........
plant    68 EE-----TWEAFVADSLLYAKIFLIAVSLIMDYRVAVWFSIIFSVIYLLAQQPAFSKLGTAKKLT 127

  Fly   134 NAQVFEEELARDKRTS--WLICFYTVWNPSCVNFAPVFAELSAEYNTDHLKFGKIDIGRFPDVAQ 196
            ..|:  |:|..|..|:  |||.|:...:..||..:..|.|||..|:.:.|.||.:|:|.||:.|.
plant   128 PMQL--EDLLSDGNTTKYWLIEFFACSSSKCVRSSRCFPELSITYSNNLLSFGTVDLGLFPNTAA 190

  Fly   197 KYRISDSSFSRQLPTVILFQQGKETDRRPCVDSKGKLQKFFFSSDNVRATFGLNQLYKEAIERLP 261
            |:.||.:....||||.|||::|.|..|.|                         ..|.:|...||
plant   191 KFGISLAGGMSQLPTYILFEKGVEVSRFP-------------------------DFYVDAAPSLP 230

  Fly   262 IAPK 265
            |..|
plant   231 ITKK 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11007NP_001286617.1 TMX2 100..251 CDD:239260 42/152 (28%)
AT5G11640NP_196725.1 TMX2 94..244 CDD:239260 48/168 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0914
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2337
OMA 1 1.010 - - QHG57880
OrthoDB 1 1.010 - - D1107509at2759
OrthoFinder 1 1.000 - - FOG0005620
OrthoInspector 1 1.000 - - oto4183
orthoMCL 1 0.900 - - OOG6_105435
Panther 1 1.100 - - LDO PTHR15853
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.840

Return to query results.
Submit another query.