DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11007 and Tmx2

DIOPT Version :9

Sequence 1:NP_001286617.1 Gene:CG11007 / 37249 FlyBaseID:FBgn0034455 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_080144.1 Gene:Tmx2 / 66958 MGIID:1914208 Length:295 Species:Mus musculus


Alignment Length:264 Identity:116/264 - (43%)
Similarity:170/264 - (64%) Gaps:12/264 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAKPYYWVNILLAISYLLAKKTQFICTRLFILAGEDEACDLDSREVEILFFLLIVVMIRSRKTGS 74
            ||:||..::.||:|::||.:|...||..|.....:...||.|.||||||.||..:||:::|:  |
Mouse    21 LARPYCLLSALLSIAFLLVRKLPPICNGLPTQREDGNPCDFDWREVEILMFLSAIVMMKNRR--S 83

  Fly    75 VTMINYLASSFLYTKVANAILWAYADFRYGLGFLLLCVLVGMVLPEPSYRGPEHITYFRNAQVFE 139
            :|:..::.:.|:::|||||||:...|.|.||.:|.||::..|....|.|.|||:|.|| |.:..:
Mouse    84 ITVEQHVGNIFMFSKVANAILFFRLDIRMGLLYLTLCIVFLMTCKPPLYMGPEYIKYF-NDKTID 147

  Fly   140 EELARDKRTSWLICFYTVWNPSCVNFAPVFAELSAEYNTDHLKFGKIDIGRFPDVAQKYRISDSS 204
            |||.||||.:|::.|:..|:..|.:|||::|:||.:||...|.|||:|:||:.||:.:|::|.|.
Mouse   148 EELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCSGLNFGKVDVGRYTDVSTRYKVSTSP 212

  Fly   205 FSRQLPTVILFQQGKETDRRPCVDSKGKLQKFFFSSDNVRATFGLNQLYKEA---------IERL 260
            .:|||||:||||.|||..|||.:|.||:...:.||.:||...|.||:||:.|         .|..
Mouse   213 LTRQLPTLILFQGGKEVIRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKHSKGGDMSEEK 277

  Fly   261 PIAP 264
            |:.|
Mouse   278 PVDP 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11007NP_001286617.1 TMX2 100..251 CDD:239260 72/150 (48%)
Tmx2NP_080144.1 TMX2 109..259 CDD:239260 72/150 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 266..295 3/16 (19%)
Di-lysine motif. /evidence=ECO:0000305 292..295
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837790
Domainoid 1 1.000 106 1.000 Domainoid score I6604
eggNOG 1 0.900 - - E1_KOG0914
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9317
Inparanoid 1 1.050 227 1.000 Inparanoid score I3466
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57880
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005620
OrthoInspector 1 1.000 - - oto91865
orthoMCL 1 0.900 - - OOG6_105435
Panther 1 1.100 - - LDO PTHR15853
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2853
SonicParanoid 1 1.000 - - X4598
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.