DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11007 and tmx2a

DIOPT Version :9

Sequence 1:NP_001286617.1 Gene:CG11007 / 37249 FlyBaseID:FBgn0034455 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001103857.1 Gene:tmx2a / 561718 ZFINID:ZDB-GENE-050208-95 Length:301 Species:Danio rerio


Alignment Length:244 Identity:95/244 - (38%)
Similarity:165/244 - (67%) Gaps:3/244 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KPYYWVNILLAISYLLAKKTQFICTRLFILAGEDEACDLDSREVEILFFLLIVVMIRSRKTGSVT 76
            :|||::::|:.:::::.:....:|..|.....:.::|..|.|||||..||..:||:::|:  :||
Zfish    23 RPYYFLSLLMTLAFVIVRCCPGLCEHLPSQREDGDSCAFDWREVEIFMFLGAIVMMKNRR--AVT 85

  Fly    77 MINYLASSFLYTKVANAILWAYADFRYGLGFLLLCVLVGMVLPEPSYRGPEHITYFRNAQVFEEE 141
            :..::.:.||::||||.:|:...|.|:||.:|.|||:..:....|:|.|||:|.|||::.: :||
Zfish    86 VEQHIGNIFLFSKVANVVLFFRVDLRFGLLYLTLCVVFLITCKPPAYMGPENIKYFRDSTI-DEE 149

  Fly   142 LARDKRTSWLICFYTVWNPSCVNFAPVFAELSAEYNTDHLKFGKIDIGRFPDVAQKYRISDSSFS 206
            |.||.|.:|::.||..|:|.|.:|||:||:||.:|....|||||:|||.:..||::|:::.|...
Zfish   150 LQRDSRVTWIVEFYANWSPECQSFAPIFADLSLKYTCLGLKFGKVDIGHYGAVAERYKVNPSPLC 214

  Fly   207 RQLPTVILFQQGKETDRRPCVDSKGKLQKFFFSSDNVRATFGLNQLYKE 255
            :|||::::.|.|:|..|||.||.||:...:.|:.||:...|.||:::::
Zfish   215 KQLPSLLMLQAGRELMRRPLVDKKGRAVSWNFTEDNIIRDFNLNEIFQK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11007NP_001286617.1 TMX2 100..251 CDD:239260 67/150 (45%)
tmx2aNP_001103857.1 TMX2 109..259 CDD:239260 67/150 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 268..301
Di-lysine motif. /evidence=ECO:0000305 298..301
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581544
Domainoid 1 1.000 102 1.000 Domainoid score I6816
eggNOG 1 0.900 - - E1_KOG0914
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I3579
OMA 1 1.010 - - QHG57880
OrthoDB 1 1.010 - - D1107509at2759
OrthoFinder 1 1.000 - - FOG0005620
OrthoInspector 1 1.000 - - otm24662
orthoMCL 1 0.900 - - OOG6_105435
Panther 1 1.100 - - O PTHR15853
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4598
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.770

Return to query results.
Submit another query.