DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11007 and tmx2b

DIOPT Version :9

Sequence 1:NP_001286617.1 Gene:CG11007 / 37249 FlyBaseID:FBgn0034455 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001002113.1 Gene:tmx2b / 415203 ZFINID:ZDB-GENE-040625-105 Length:307 Species:Danio rerio


Alignment Length:266 Identity:110/266 - (41%)
Similarity:169/266 - (63%) Gaps:16/266 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LAKPYYWVNILLAISYLLAKKTQFICTRLFILAGEDEACDLDSREVEILFFLLIVVMIRSRKTGS 74
            |.||||..::.::|::::.:|...:|..|.....:..:||.|.||||||.||..:||:::|:  :
Zfish    21 LLKPYYIASLFMSIAFVMIRKMPGVCEHLSTQREDGNSCDFDWREVEILMFLSAIVMMKNRR--A 83

  Fly    75 VTMINYLASSFLYTKVANAILWAYADFRYGLGFLLLCVLVGMVLPEPSYRGPEHITYFRNAQVFE 139
            :|:..::.:..|:.||||.||:...|.|.||.:|.||::..|....|.|.|||:|.||.: :..:
Zfish    84 ITIEQHVGNIILFCKVANVILFFRLDIRLGLLYLTLCIVFLMTCKPPLYMGPEYIKYFSD-KTID 147

  Fly   140 EELARDKRTSWLICFYTVWNPSCVNFAPVFAELSAEYNTDHLKFGKIDIGRFPDVAQKYRISDSS 204
            |||.:|.|.:|::.|:..|:|.|.:||.|:|:||.:||...|||||:||||:.:|::|||:|.|.
Zfish   148 EELEKDHRVTWIVEFFANWSPECQSFASVYADLSLKYNCAGLKFGKVDIGRYGEVSKKYRVSTSP 212

  Fly   205 FSRQLPTVILFQQGKETDRRPCVDSKGKLQKFFFSSDNVRATFGLNQLY---------KEAIERL 260
            .|:|||:::|||.|||..|||.||.||:...:.|:.:|:...|.||:||         ||.:|| 
Zfish   213 LSKQLPSLVLFQGGKEVMRRPQVDKKGRAVSWTFTEENIIREFNLNELYQKSKKLGKTKEKLER- 276

  Fly   261 PIAPKE 266
               |.|
Zfish   277 ---PSE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11007NP_001286617.1 TMX2 100..251 CDD:239260 70/150 (47%)
tmx2bNP_001002113.1 TMX2 109..259 CDD:239260 70/150 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 268..307 6/16 (38%)
Di-lysine motif. /evidence=ECO:0000305 304..307
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581543
Domainoid 1 1.000 102 1.000 Domainoid score I6816
eggNOG 1 0.900 - - E1_KOG0914
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9317
Inparanoid 1 1.050 217 1.000 Inparanoid score I3579
OMA 1 1.010 - - QHG57880
OrthoDB 1 1.010 - - D1107509at2759
OrthoFinder 1 1.000 - - FOG0005620
OrthoInspector 1 1.000 - - otm24662
orthoMCL 1 0.900 - - OOG6_105435
Panther 1 1.100 - - LDO PTHR15853
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2853
SonicParanoid 1 1.000 - - X4598
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.