DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11007 and C35D10.10

DIOPT Version :9

Sequence 1:NP_001286617.1 Gene:CG11007 / 37249 FlyBaseID:FBgn0034455 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_498012.1 Gene:C35D10.10 / 175646 WormBaseID:WBGene00016446 Length:265 Species:Caenorhabditis elegans


Alignment Length:252 Identity:101/252 - (40%)
Similarity:162/252 - (64%) Gaps:7/252 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ALLAKPYYWVNILLAISYLLAKKTQFICTRLFILAGEDEACDLDSREVEILFFLLIVVMIRSRKT 72
            ||.|  :::.|.|||:::.:.:.|. :|..:|.:.| :|.|::||||.|||.||||::..:.|| 
 Worm    12 ALTA--FHFFNTLLALAFPVIRSTS-LCDYVFAVEG-NEQCEIDSREREILMFLLIILAWKGRK- 71

  Fly    73 GSVTMINYLASSFLYTKVANAILWAYADFRYGLGFLLLCVLVGMVLPEPSYRGPEHITYFRNAQV 137
             :...::|:.:.||::|:|...|:..||...|:.::|.|::|.::.|||.|.|||.:|||:..|:
 Worm    72 -ATNWMHYVNNIFLFSKIAGMFLFIRADILPGIIYILACLIVTVLFPEPVYNGPEQVTYFQGEQL 135

  Fly   138 FEEELARDKRTSWLICFYTVWNPSCVNFAPVFAELSAEYNTDHLKFGKIDIGRFPDVAQKYRISD 202
            | |||.|::.|.|:|.|:|.|:|.|.:.:|||||||.::...::||||:||||:....:::|::.
 Worm   136 F-EELTRNRNTIWVIQFFTTWSPECRHTSPVFAELSQKFTLPNMKFGKLDIGRWAKEGERFRVNA 199

  Fly   203 SSFSRQLPTVILFQQGKETDRRPCVDSKGKLQKFFFSSDNVRATFGLNQLYKEAIER 259
            ...||||||:.:|:..||..|||.|:...:...|.||.:|....|.|..||.|..|:
 Worm   200 HPMSRQLPTICVFKDAKEIARRPLVNDSRRAVPFVFSEENCVLAFDLLNLYNEQKEK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11007NP_001286617.1 TMX2 100..251 CDD:239260 64/150 (43%)
C35D10.10NP_498012.1 TMX2 98..248 CDD:239260 64/150 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159695
Domainoid 1 1.000 91 1.000 Domainoid score I4919
eggNOG 1 0.900 - - E1_KOG0914
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9317
Inparanoid 1 1.050 196 1.000 Inparanoid score I2512
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57880
OrthoDB 1 1.010 - - D1107509at2759
OrthoFinder 1 1.000 - - FOG0005620
OrthoInspector 1 1.000 - - oto18744
orthoMCL 1 0.900 - - OOG6_105435
Panther 1 1.100 - - LDO PTHR15853
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2853
SonicParanoid 1 1.000 - - X4598
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.