DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15120 and Pacrgl

DIOPT Version :9

Sequence 1:NP_611428.1 Gene:CG15120 / 37248 FlyBaseID:FBgn0034454 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_080031.1 Gene:Pacrgl / 66768 MGIID:1914018 Length:248 Species:Mus musculus


Alignment Length:288 Identity:81/288 - (28%)
Similarity:119/288 - (41%) Gaps:56/288 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RSKSANPAQLR-PLSGIHGAAVSSRPRYVPPFSIQSQQKNTVVIDGPIHETAPKTASARSRVPNP 87
            ||:.:...||| ..:|.:....||        |.|.:.:.||........|:...|:.|:| |.|
Mouse     3 RSECSGGVQLRNRATGSNDQRTSS--------STQMKHRTTVQRSKSSSLTSSPEAARRAR-PRP 58

  Fly    88 KILRRQQKSMSTFNLGMGLNGCSTGGANDPGRGTLFRMYFDRGDLPIKMEYLCGGDKIGWTVDIE 152
            .. :...|:::.|             ...|...|.|...:.:|.:|.::.:.....::.|....|
Mouse    59 SD-KLNPKTINPF-------------GEQPRAPTAFAAIYSQGGIPCRLVHGSVKHRLQWECPPE 109

  Fly   153 KLDYSLYLPLFFDGLAETKHPYKTYARQGVTDLLLAGG--EKIHPVIPQLILPLKNALSTRNLEV 215
            .|.:...|....:||.||||||...:::|..:|||..|  ||..|::|:||..||.||...:.||
Mouse   110 ILPFDPLLITLAEGLRETKHPYTFVSKEGFRELLLVKGAPEKAIPLLPRLIPVLKAALVHSDDEV 174

  Fly   216 MCTTLKIIQQLVMSSDLVGPALVPFYRQLLP------MFNAFKVKNLNCGDEIDYAQKNNLNLGD 274
            ....|..:.||   |.:|||:|....:.||.      |...||                     :
Mouse   175 FERGLSALVQL---SVVVGPSLNGHLKLLLTSLSKRLMDKKFK---------------------E 215

  Fly   275 LIDETLQVLELHGGEDAFINIKYMVPTY 302
            .|...||.||.|||..:.|.||..:|||
Mouse   216 PITSALQKLEQHGGNASLIIIKSKIPTY 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15120NP_611428.1 ParcG 121..304 CDD:255872 60/190 (32%)
PacrglNP_080031.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..72 20/91 (22%)
ParcG 78..245 CDD:255872 60/190 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3961
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3747
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.