DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15120 and Pacrg

DIOPT Version :9

Sequence 1:NP_611428.1 Gene:CG15120 / 37248 FlyBaseID:FBgn0034454 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001376167.1 Gene:Pacrg / 499021 RGDID:1561027 Length:257 Species:Rattus norvegicus


Alignment Length:264 Identity:130/264 - (49%)
Similarity:171/264 - (64%) Gaps:28/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RPRYVPPFSIQSQQKNTVVIDGPIHETAPKTASARSRVPNPKILRRQQKSMSTFNLGMGLNGCST 111
            |.:.:|..:||..|.:::|.:|...:...|.:..|                          |...
  Rat    20 RTKLLPQQTIQVHQPHSLVSEGFTVKAMMKNSVVR--------------------------GPPA 58

  Fly   112 GGA--NDPGRGTLFRMYFDRGDLPIKMEYLCGGDKIGWTVDIEKLDYSLYLPLFFDGLAETKHPY 174
            .||  ..|.:.|.||.:::|||.||.:|:...|:||.|.|:||||||..|||||||||.|...||
  Rat    59 AGAFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMTFPY 123

  Fly   175 KTYARQGVTDLLLAGGEKIHPVIPQLILPLKNALSTRNLEVMCTTLKIIQQLVMSSDLVGPALVP 239
            :.:||||:.|:|..||.||.|||||||:|:||||:.||.:|:|.|||::|.||:|:::||.||||
  Rat   124 EFFARQGIHDMLEHGGNKILPVIPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAEMVGEALVP 188

  Fly   240 FYRQLLPMFNAFKVKNLNCGDEIDYAQKNNLNLGDLIDETLQVLELHGGEDAFINIKYMVPTYES 304
            :|||:||:.|.||..|:|.||.|||:|:...|:||||.|||:..|.:||||||||||||||||||
  Rat   189 YYRQILPILNIFKNMNVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGEDAFINIKYMVPTYES 253

  Fly   305 CYLN 308
            |.||
  Rat   254 CLLN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15120NP_611428.1 ParcG 121..304 CDD:255872 112/182 (62%)
PacrgNP_001376167.1 ParcG 70..253 CDD:402064 112/182 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1095804at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.