DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15120 and pacrg

DIOPT Version :9

Sequence 1:NP_611428.1 Gene:CG15120 / 37248 FlyBaseID:FBgn0034454 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001007399.1 Gene:pacrg / 492757 ZFINID:ZDB-GENE-041114-100 Length:232 Species:Danio rerio


Alignment Length:255 Identity:132/255 - (51%)
Similarity:170/255 - (66%) Gaps:39/255 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 FSIQSQQKNTVVIDGPIHETAPKTASARSRVPNPKILRRQQKSMSTFNLGMGLNGCSTGGANDPG 118
            |::.|..||:||: ||     |...:.|.|                                 |.
Zfish    17 FTVMSTMKNSVVV-GP-----PAAGAFRER---------------------------------PA 42

  Fly   119 RGTLFRMYFDRGDLPIKMEYLCGGDKIGWTVDIEKLDYSLYLPLFFDGLAETKHPYKTYARQGVT 183
            :.|.||.:::|||.||.:|:...|::|.|.|:||||||..|||||||||.||.|||:.:||||:.
Zfish    43 KPTAFRKFYERGDFPIALEHDSKGNRIAWKVEIEKLDYHHYLPLFFDGLCETVHPYEFFARQGIH 107

  Fly   184 DLLLAGGEKIHPVIPQLILPLKNALSTRNLEVMCTTLKIIQQLVMSSDLVGPALVPFYRQLLPMF 248
            |:|..||.|:.|||||||:|:||||:|||.:|:|||||::|.||:|:::||.||||:|||:||:.
Zfish   108 DMLEHGGNKVLPVIPQLIIPIKNALNTRNRQVICTTLKVLQHLVVSAEMVGEALVPYYRQILPIL 172

  Fly   249 NAFKVKNLNCGDEIDYAQKNNLNLGDLIDETLQVLELHGGEDAFINIKYMVPTYESCYLN 308
            |.||..|.|.||.|||:|:...|:||||.|||:|.|.:|||||||||||||||||||.||
Zfish   173 NIFKNMNKNSGDGIDYSQQKRENIGDLIQETLEVFERYGGEDAFINIKYMVPTYESCLLN 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15120NP_611428.1 ParcG 121..304 CDD:255872 115/182 (63%)
pacrgNP_001007399.1 ParcG 45..228 CDD:255872 115/182 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585498
Domainoid 1 1.000 251 1.000 Domainoid score I2061
eggNOG 1 0.900 - - E1_KOG3961
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H16212
Inparanoid 1 1.050 261 1.000 Inparanoid score I3099
OMA 1 1.010 - - QHG56483
OrthoDB 1 1.010 - - D1095804at2759
OrthoFinder 1 1.000 - - FOG0005412
OrthoInspector 1 1.000 - - oto40860
orthoMCL 1 0.900 - - OOG6_104001
Panther 1 1.100 - - LDO PTHR21207
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3747
SonicParanoid 1 1.000 - - X5762
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.