DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15120 and CG17349

DIOPT Version :9

Sequence 1:NP_611428.1 Gene:CG15120 / 37248 FlyBaseID:FBgn0034454 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_609957.2 Gene:CG17349 / 35209 FlyBaseID:FBgn0032771 Length:266 Species:Drosophila melanogaster


Alignment Length:265 Identity:103/265 - (38%)
Similarity:142/265 - (53%) Gaps:53/265 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 RYVPPFSIQSQQKNTVVIDGPIHETAPKTASARSRVPNPKILRRQQKSMSTFNLGMGLNGCSTGG 113
            |.||.|:.|:.|.||||                  .|.|||...::|                  
  Fly    32 REVPAFTFQALQPNTVV------------------KPPPKIDIFKRK------------------ 60

  Fly   114 ANDPGRGTLFRMYFDRGDLPIKMEYLCGGDK---------IGWTVDIEKLDYSLYLPLFFDGLAE 169
               |.:.|:|::||:|||:|..|.   |...         :.|....|.|||..|||:|.||||:
  Fly    61 ---PVKETVFKIYFNRGDIPCVMS---GRSSKQDPTKERPVKWHCVPENLDYCYYLPIFVDGLAD 119

  Fly   170 TKHPYKTYARQGVTDLLLAGGEKIHPVIPQLILPLKNALSTRNLEVMCTTLKIIQQLVMSSDLVG 234
            ..:..:..|..|..||::...:|:.||:|:||||||.|..||:..::.:.|::||.:|.....||
  Fly   120 MDYDTRLLAVNGAIDLIMRSPKKVLPVLPKLILPLKRAFQTRDKRIIISALQVIQLMVRLGPCVG 184

  Fly   235 PALVPFYRQLLPMFNAFKVKNLNCGDEIDYAQKNNLNLGDLIDETLQVLELHGGEDAFINIKYMV 299
            .||||||||||.:.|.:|..|:|.|:.||  ...|..:||:|::||::||..||.:|||||||||
  Fly   185 QALVPFYRQLLAVCNLYKNINVNLGEGID--PDRNCRIGDVIEDTLKLLEYCGGPNAFINIKYMV 247

  Fly   300 PTYES 304
            |||||
  Fly   248 PTYES 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15120NP_611428.1 ParcG 121..304 CDD:255872 85/191 (45%)
CG17349NP_609957.2 ParcG 65..252 CDD:402064 85/191 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454809
Domainoid 1 1.000 92 1.000 Domainoid score I4801
eggNOG 1 0.900 - - E1_KOG3961
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I3504
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104585at50557
OrthoFinder 1 1.000 - - FOG0005412
OrthoInspector 1 1.000 - - otm14212
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21207
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.