DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15120 and pacrg

DIOPT Version :9

Sequence 1:NP_611428.1 Gene:CG15120 / 37248 FlyBaseID:FBgn0034454 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001106393.1 Gene:pacrg / 100127543 XenbaseID:XB-GENE-6258806 Length:240 Species:Xenopus tropicalis


Alignment Length:255 Identity:133/255 - (52%)
Similarity:170/255 - (66%) Gaps:39/255 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 FSIQSQQKNTVVIDGPIHETAPKTASARSRVPNPKILRRQQKSMSTFNLGMGLNGCSTGGANDPG 118
            |::::..||::| .||     |...:.:.|                                 |.
 Frog    25 FTVKAMMKNSIV-RGP-----PAAGAFKER---------------------------------PA 50

  Fly   119 RGTLFRMYFDRGDLPIKMEYLCGGDKIGWTVDIEKLDYSLYLPLFFDGLAETKHPYKTYARQGVT 183
            :.|.||.:::|||.||.:|:...|:||.|.|:||||||..|||||||||.||.|||:.:|||||.
 Frog    51 KPTAFRKFYERGDFPIALEHDTKGNKIAWKVEIEKLDYHHYLPLFFDGLCETTHPYEFFARQGVH 115

  Fly   184 DLLLAGGEKIHPVIPQLILPLKNALSTRNLEVMCTTLKIIQQLVMSSDLVGPALVPFYRQLLPMF 248
            |:|..||.||.|||||||:|:||||:.||.:|:|||||::|.||:|:|:||.||||:|||:||:|
 Frog   116 DMLEHGGPKILPVIPQLIIPIKNALNIRNRQVICTTLKVLQHLVVSADMVGEALVPYYRQILPIF 180

  Fly   249 NAFKVKNLNCGDEIDYAQKNNLNLGDLIDETLQVLELHGGEDAFINIKYMVPTYESCYLN 308
            |.||..|:|.||.|||:|:...|:||||.|||:..|.||||||||||||||||||||.||
 Frog   181 NIFKNVNINSGDGIDYSQQKRENIGDLIQETLEAFERHGGEDAFINIKYMVPTYESCLLN 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15120NP_611428.1 ParcG 121..304 CDD:255872 119/182 (65%)
pacrgNP_001106393.1 ParcG 53..236 CDD:255872 119/182 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 257 1.000 Domainoid score I1989
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H16212
Inparanoid 1 1.050 266 1.000 Inparanoid score I2974
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1095804at2759
OrthoFinder 1 1.000 - - FOG0005412
OrthoInspector 1 1.000 - - oto104897
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5762
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.