DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hpo and SKM1

DIOPT Version :9

Sequence 1:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_014528.1 Gene:SKM1 / 854036 SGDID:S000005473 Length:655 Species:Saccharomyces cerevisiae


Alignment Length:327 Identity:108/327 - (33%)
Similarity:176/327 - (53%) Gaps:32/327 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VVDMKSPNISSSCSFFKLKKLSEESLLQPPEKVFDIMYKLGEGSYGSVYKA-------------- 59
            ::::|: |..|:....|:|.::.:   ..|...|.::.|.|:|:.|:||.:              
Yeast   331 LLELKN-NDDSNEIIMKMKTVAID---VNPRPYFQLVEKAGQGASGAVYLSKRIKLPQENDPRFL 391

  Fly    60 ---VHKESSSIVAIKLVPVESDLHE--IIKEISIMQQCDSPYVVRYYGSY-FKQYDLWICMEYCG 118
               .|:.....||||.:.:.....:  |:.|:.:|.......:|.:..:| ....:||:.|||..
Yeast   392 KSHCHRVVGERVAIKQIRLSEQPKKQLIMNELLVMNDSRQENIVNFLEAYIIDDEELWVIMEYME 456

  Fly   119 AGSVSDIMR--LRKKT------LTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNTEGYA 175
            .|.::||:.  .|..|      |.|:::|.|:.:|.|||.:||.::.||||||:.|||||::|..
Yeast   457 GGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLV 521

  Fly   176 KLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEIH 240
            |:.|||...:||:..:||.|::|||:|||||::.:.|||...|:|||||..:||.||:|||....
Yeast   522 KITDFGFCVELTEKRSKRATMVGTPYWMAPEIVNQKGYDEKVDVWSLGIMLIEMIEGEPPYLNED 586

  Fly   241 PMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELLEHEFIRNAKHRSILKPM 305
            |::|:::|.....|..|.|:..|.:...|:..||....:.||:..:||..||:..|.....||..
Yeast   587 PLKALYLIANNGSPKLRHPESVSKQTKQFLDACLQVNVESRASVRKLLTFEFLSMACSPEQLKVS 651

  Fly   306 LE 307
            |:
Yeast   652 LK 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 98/282 (35%)
S_TKc 42..293 CDD:214567 97/278 (35%)
Mst1_SARAH 608..655 CDD:288481
SKM1NP_014528.1 PH_Cla4_Ste20 4..113 CDD:270097
PBD 122..180 CDD:395634
STKc_PAK 359..640 CDD:270789 98/280 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.