DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hpo and BCK1

DIOPT Version :9

Sequence 1:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_012440.1 Gene:BCK1 / 853350 SGDID:S000003631 Length:1478 Species:Saccharomyces cerevisiae


Alignment Length:318 Identity:97/318 - (30%)
Similarity:154/318 - (48%) Gaps:49/318 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LGEGSYGSVYKAVHKESSSIVAIKL--VPVESDLHEII--------KEISIMQQCDSPYVVRYYG 102
            :|:||:|:||..::..:..::|:|.  ||..|..:|.|        .|:|.::..|...:|:|.|
Yeast  1181 IGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIVQYLG 1245

  Fly   103 SYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANI 167
            ...|.....:.:||...|||..::|:..: ..|..|..:.:..|:||.|||.:..:|||:||.|:
Yeast  1246 FENKNNIYSLFLEYVAGGSVGSLIRMYGR-FDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNL 1309

  Fly   168 LLNTEGYAKLADFGVAGQLTDTMAKRN-TVIGTPFWMAPEVIE-EIGYDCVADIWSLGITALEMA 230
            ||:.:|..|::|||::.:..|..:..: |:.||.||||||::: :.||....||||||...|||.
Yeast  1310 LLDQDGICKISDFGISRKSKDIYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMF 1374

  Fly   231 EGKPPYGEIHPMRAIFM---------IPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATE 286
            .||.|:..:..:.|:|.         ||:...|...:..|      :|:..|....|:.|.||.|
Yeast  1375 AGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGR------NFLDACFEINPEKRPTANE 1433

  Fly   287 LLEHEFIR-----NAKHRSILKPMLEETCAIREQQRANRSFGGVLAASQAKSLATQEN 339
            ||.|.|..     |.|...:.|       .|:...:.|         |....:.:|||
Yeast  1434 LLSHPFSEVNETFNFKSTRLAK-------FIKSNDKLN---------SSKLRITSQEN 1475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 87/265 (33%)
S_TKc 42..293 CDD:214567 87/265 (33%)
Mst1_SARAH 608..655 CDD:288481
BCK1NP_012440.1 STKc_Bck1_like 1173..1440 CDD:270799 87/265 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.