DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hpo and MAPKKK15

DIOPT Version :9

Sequence 1:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001330365.1 Gene:MAPKKK15 / 835600 AraportID:AT5G55090 Length:510 Species:Arabidopsis thaliana


Alignment Length:435 Identity:119/435 - (27%)
Similarity:188/435 - (43%) Gaps:85/435 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VDMKSPNISS--------SCSFFKLKKLSEESLLQPPEKVFDIMYKLGEGSYGSVYKAVHKESSS 66
            |...|.:|||        |||.    .:.|::.::.|        .:|.||..:|...: ..|..
plant    40 VHFLSLSISSVFFVPLFFSCSV----SMEEQNWIRGP--------IIGRGSTATVSLGI-TNSGD 91

  Fly    67 IVAIKLVPVESDLHEIIKEISIMQQCDSPYVVRYYGSYFKQ------YDLWICMEYCGAGSVSDI 125
            ..|:|.....|... :.:|.||:.:..|||:|:|.||...:      |:|  .|||...||:.|:
plant    92 FFAVKSAEFSSSAF-LQREQSILSKLSSPYIVKYIGSNVTKENDKLMYNL--LMEYVSGGSLHDL 153

  Fly   126 MRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQLTDTM 190
            ::.....|.|..|.:.....|:||:|||.:..:|.|:|:.|:::..| .||:.|.|.|..:.:. 
plant   154 IKNSGGKLPEPLIRSYTRQILKGLMYLHDQGIVHCDVKSQNVMIGGE-IAKIVDLGCAKTVEEN- 216

  Fly   191 AKRNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEIHP-MRAIFMI------ 248
             :.....|||.:|:|||.........||:|:||.|.:|||.|..|:.|::. :.||:.|      
plant   217 -ENLEFSGTPAFMSPEVARGEEQSFPADVWALGCTVIEMATGSSPWPELNDVVAAIYKIGFTGES 280

  Fly   249 PQKPPPSFREPDRW-STEFIDFVSKCLVKEPDDRATATELLEHEF--------------IRNAKH 298
            |..|.        | |.:..||:.|||.|:|..|.|..|||:|.|              :.::..
plant   281 PVIPV--------WLSEKGQDFLRKCLRKDPKQRWTVEELLQHPFLDEEDNDSDQTGNCLNSSSP 337

  Fly   299 RSILKPMLEETCA------IREQQR---ANRS----FGGVLAASQAKSLATQENGMQQHITDNAF 350
            .::|.....:.|.      |:|...   ||.:    ....|...:.|.||..|:..:.....|.:
plant   338 STVLDQRFWDLCETSRSRFIKEDHEDPFANSTNFLWDDDSLPGDRIKKLAGDESSGEPDWETNGW 402

  Fly   351 MEDPGTLVPEKFGEYQQSSASDATMIAHAEQGVDEGTLGPGGLRN 395
            :|..|.:  ||..|.:..:..:||.:...|:.|       ||..|
plant   403 IEVRGEI--EKRNEEEDENCVEATSLEEDEEEV-------GGFEN 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 86/282 (30%)
S_TKc 42..293 CDD:214567 85/278 (31%)
Mst1_SARAH 608..655 CDD:288481
MAPKKK15NP_001330365.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.