DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hpo and AT4G14350

DIOPT Version :9

Sequence 1:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001329677.1 Gene:AT4G14350 / 827078 AraportID:AT4G14350 Length:551 Species:Arabidopsis thaliana


Alignment Length:305 Identity:86/305 - (28%)
Similarity:139/305 - (45%) Gaps:50/305 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FDIMYKLGEGSYGSVYKAVHKESSSIVAIKLVPVESDLH----EIIK-EISIMQQCDSPYVVRYY 101
            |:.:..:|:|::|.|.....|.:.::.|:|.:.....|.    |.:| |.:::.:.||..:|:.|
plant   119 FEPLTMIGKGAFGEVRICREKGTGNVYAMKKLKKSEMLRRGQVEHVKAERNLLAEVDSNCIVKLY 183

  Fly   102 GSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAAN 166
            .|:..:..|::.|||...|.:..:: :||.||||||....:.:|:..:..:|....||||||..|
plant   184 CSFQDEEYLYLIMEYLPGGDMMTLL-MRKDTLTEDEARFYIGETVLAIESIHKHNYIHRDIKPDN 247

  Fly   167 ILLNTEGYAKLADFG--------------------VAGQLTD---TMAKRNT------------- 195
            :||:.:|:.||:|||                    |:|.|..   .:|.|.|             
plant   248 LLLDKDGHMKLSDFGLCKPLDCSNLQEKDFTVARNVSGALQSDGRPVATRRTQQEQLLNWQRNRR 312

  Fly   196 -----VIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQ-KPPP 254
                 .:|||.::||||:.:.||....|.||||....||..|.||:....||.....|.. :...
plant   313 MLAYSTVGTPDYIAPEVLLKKGYGMECDWWSLGAIMYEMLVGFPPFYSDDPMTTCRKIVNWRNYL 377

  Fly   255 SFREPDRWSTEFIDFVSK--CLVKEPDDRATATELLEHEFIRNAK 297
            .|.:..|.|.|..|.:.:  |.|::......|.|:..|.:.|..:
plant   378 KFPDEVRLSPEAKDLICRLLCNVEQRLGTKGADEIKGHPWFRGTE 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 85/299 (28%)
S_TKc 42..293 CDD:214567 85/299 (28%)
Mst1_SARAH 608..655 CDD:288481
AT4G14350NP_001329677.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.